Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RecombinantTWEAK, Human

TWEAK, short for TNF-related weak inducer of apoptosis, is also known as TNFSF12 and DR3LG. It is a type II transmembrane protein belonging to the TNF superfamily. It is expressed widely in many tissues, such as the heart, skeletal muscle, spleen and peripheral blood. Binding of TWEAK to its receptor TWEAKR induces NF-κB activation, chemokine secretion and apoptosis in certain cell types. TWEAK has also been reported to promote endothelial cell proliferation and migration, thus serving as a regulator of angiogenesis.

Product Specifications

CAS Number

9000-83-3

Endotoxin

< 0.2 EU/μg, determined by LAL method.

Purity

> 95% as analyzed by SDS-PAGE and HPLC.

Bioactivity

ED50 < 1 ng/ml, measured in a cell cytotoxicity assay using HTB-38 (HT-29) cells.

Reconstitution

Reconstituted in ddH2O or PBS at 100 μg/ml.

Molecular Weight

20-22 kDa, observed by reducing SDS-PAGE.

Storage Conditions

Lyophilized recombinant Human TWEAK remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, Human TWEAK should be stable up to 1 week at 4°C or up to 2 months at -20°C.

Appearance

Sterile Filtered White lyophilized (freeze-dried) powder.

Formulation

Lyophilized after extensive dialysis against PBS.

Host or Source

CHO

Recommended Usage

This material is offered by USA Bioworld biotech for research, laboratory or further evaluation purposes. For research use only.

AA Sequence

RKTRARRAIAAHYEVHPRPGQDGAQAGVDGTVSGWEEARINSSSPLRYNRQIGEFIVTRAGLYYLYCQVHFDEGKAVYLK LDLLVDGVLALRCLEEFSATAASSLGPQLRLCQVSGLLALRPGSSLRIRTLPWAHLKAAPFLTYFGLFQVH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FICD Antibody, Biotin conjugated
MBS7108662-01 0.05 mg

FICD Antibody, Biotin conjugated

Sign In for Pricing
View Details
FICD Antibody, Biotin conjugated
MBS7108662-02 0.1 mg

FICD Antibody, Biotin conjugated

Sign In for Pricing
View Details
FICD Antibody, Biotin conjugated
MBS7108662-03 5x 0.1 mg

FICD Antibody, Biotin conjugated

Sign In for Pricing
View Details
Phospho-Tau Rabbit Monoclonal Antibody
orb865784 100 µL

Phospho-Tau Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Monkey Total Procollagen Type I Intact N-Terminal Propeptide (TP1NP) ELISA Kit
MBS9343672-01 48 Well

Monkey Total Procollagen Type I Intact N-Terminal Propeptide (TP1NP) ELISA Kit

Sign In for Pricing
View Details
Monkey Total Procollagen Type I Intact N-Terminal Propeptide (TP1NP) ELISA Kit
MBS9343672-02 96 Well

Monkey Total Procollagen Type I Intact N-Terminal Propeptide (TP1NP) ELISA Kit

Sign In for Pricing
View Details