Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RecombinantTPO, Mouse

Thrombopoietin (TPO), also known as C-mpl ligand, MGDF and Thpo, is a glycoprotein hormone belonging to the EPO/TPO family. It is expressed mainly in the liver, kidney and skeletal muscle. TPO binds and signals through MLP/C_MPL receptor. It stimulates the proliferation and maturation of megakaryocytes from their committed progenitor cells, and it regulates the production and circulation of platelets. TPO has also been reported to promote the apoptosis of hypoxia-sensitized neurons and to inhibit neuronal differentiation.

Product Specifications

CAS Number

9000-83-3

Endotoxin

< 0.2 EU/μg, determined by LAL method.

Purity

> 95% as analyzed by SDS-PAGE.

Bioactivity

ED50 < 2 ng /ml, measured in a proliferation assay using MO7e cells.

Reconstitution

Reconstituted in ddH2O or PBS at 100 μg/ml..

Molecular Weight

30-80 kDa, observed by reducing SDS-PAGE.

Storage Conditions

Lyophilized recombinant murine Thrombopoietin (TPO) remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, murine Thrombopoietin (TPO) should be stable up to 1 week at 4°C or up to 2 months at -20°C.

Appearance

Sterile Filtered White lyophilized (freeze-dried) powder.

Formulation

Lyophilized after extensive dialysis against PBS.

Host or Source

CHO

Recommended Usage

This material is offered by USA Bioworld biotech for research, laboratory or further evaluation purposes. For research use only.

AA Sequence

SPVAPACDPRLLNKLLRDSHLLHSRLSQCPDVDPLSIPVLLPAVDFSLGEWKTQTEQSKAQDILGAVSLLLEGVMAARGQ LEPSCLSSLLGQLSGQVRLLLGALQGLLGTQLPLQGRTTAHKDPNALFLSLQQLLRGKVRFLLLVEGPTLCVRRTLPTTA VPSSTSQLLTLNKFPNRTSGLLETNFSVTARTAGPGLLSRLQGFRVKITPGQLNQTSRSPVQISGYLNRTHGPVNGTHGL FAGTSLQTLEASDISPGAFNKGSLAFNLQGGLPPSPSLAPDGHTPFPPSPALPTTHGSPPQLHPLFPDPSTTMPNSTAPH PVTMYPHPRNLSQET

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

AdmiRa-mmu-mir-6336 Virus
mm0974 250 µL

AdmiRa-mmu-mir-6336 Virus

Ask
View Details
ZIM2 (Zinc Finger imprinted 2, Zinc Finger Protein 656, ZIM2, ZNF656)
302863 200 µL

ZIM2 (Zinc Finger imprinted 2, Zinc Finger Protein 656, ZIM2, ZNF656)

Ask
View Details
BIM (Bcl2-interacting Mediator of Cell Death, BimEL, BimL, BIM-alpha6, BIM-beta6, BIM-beta7, BAM, BCL2-like 11 Apoptosis Facilitator, Bcl-2-like Protein 11, BCL2L11, Bcl2-L-11, BOD) (MaxLight 650)
MBS6221108-01 0.1 mL

BIM (Bcl2-interacting Mediator of Cell Death, BimEL, BimL, BIM-alpha6, BIM-beta6, BIM-beta7, BAM, BCL2-like 11 Apoptosis Facilitator, Bcl-2-like Protein 11, BCL2L11, Bcl2-L-11, BOD) (MaxLight 650)

Ask
View Details
BIM (Bcl2-interacting Mediator of Cell Death, BimEL, BimL, BIM-alpha6, BIM-beta6, BIM-beta7, BAM, BCL2-like 11 Apoptosis Facilitator, Bcl-2-like Protein 11, BCL2L11, Bcl2-L-11, BOD) (MaxLight 650)
MBS6221108-02 5x 0.1 mL

BIM (Bcl2-interacting Mediator of Cell Death, BimEL, BimL, BIM-alpha6, BIM-beta6, BIM-beta7, BAM, BCL2-like 11 Apoptosis Facilitator, Bcl-2-like Protein 11, BCL2L11, Bcl2-L-11, BOD) (MaxLight 650)

Ask
View Details
Lentiviral human EFR3A shRNA (UAS) - Lentiviral human EFR3A shRNA (UAS, GFP) (100)
GTR15144585 1 Vial

Lentiviral human EFR3A shRNA (UAS) - Lentiviral human EFR3A shRNA (UAS, GFP) (100)

Ask
View Details
Rat Cpsf7 ELISA Kit
ELI-09067r 96 Tests

Rat Cpsf7 ELISA Kit

Ask
View Details