Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RecombinantTNFRI, Human

TNF Receptor Type I, is also known as TNF R-p55/p60 and TNFRSF1A. It is a type I transmembrane protein member of the TNF receptor superfamily. It is expressed in most cell types. Binding of either TNF-α or TNF-β to TNF-R1 initiates a signal transduction pathway that results in the activation of the transcription factor NF-κB, whose target genes are involved in the regulation of inflammatory responses, and, in certain cells, induce apoptosis. TNF-R1 is essential for proper development of lymph node germinal centers and Peyer’s patches and for combating intracellular pathogens such as Listeria. It is stored in the Golgi and translocates to the cell surface following proinflammatory stimuli.

Product Specifications

CAS Number

9000-83-3

Endotoxin

< 0.2 EU/μg, determined by LAL method.

Purity

> 95% as analyzed by SDS-PAGE.

Bioactivity

ED50 < 50 ng/ml, measured in a cell proliferation assay using 929 cells in the presence of 1 ng/ml human TNF-α.

Reconstitution

Reconstituted in ddH2O or PBS at 100 μg/ml.

Molecular Weight

28~35 kDa, observed by reducing SDS-PAGE.

Storage Conditions

Lyophilized recombinant Human TNF Receptor Type I remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, Human TNF Receptor Type I should be stable up to 1 week at 4°C or up to 2 months at -20°C.

Appearance

Sterile Filtered White lyophilized (freeze-dried) powder.

Formulation

Lyophilized after extensive dialysis against PBS.

Host or Source

CHO

Recommended Usage

This material is offered by USA Bioworld biotech for research, laboratory or further evaluation purposes. For research use only.

AA Sequence

DSVCPQGKYIHPQNNSICCTKCHKGTYLYNDCPGPGQDTDCRECESGSFTASENHLRHCLSCSKCRKEMGQVEISSCTVD RDTVCGCRKNQYRHYWSENLFQCFNCSLCLNGTVHLSCQEKQNTVCTCHAGFFLRENECVSCSNCKKSLECTKLCLPQIE N

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Camel Choline-Phosphate Cytidylyltransferase B (PCYT1B) ELISA Kit
MBS9916233-01 48 Well

Camel Choline-Phosphate Cytidylyltransferase B (PCYT1B) ELISA Kit

Sign In for Pricing
View Details
Camel Choline-Phosphate Cytidylyltransferase B (PCYT1B) ELISA Kit
MBS9916233-02 96 Well

Camel Choline-Phosphate Cytidylyltransferase B (PCYT1B) ELISA Kit

Sign In for Pricing
View Details
Camel Choline-Phosphate Cytidylyltransferase B (PCYT1B) ELISA Kit
MBS9916233-03 5x 96 Well

Camel Choline-Phosphate Cytidylyltransferase B (PCYT1B) ELISA Kit

Sign In for Pricing
View Details
Camel Choline-Phosphate Cytidylyltransferase B (PCYT1B) ELISA Kit
MBS9916233-04 10x 96 Well

Camel Choline-Phosphate Cytidylyltransferase B (PCYT1B) ELISA Kit

Sign In for Pricing
View Details
Monkey Inducible T-Cell Co Stimulator Ligand ELISA Kit
MBS080330-01 48 Well

Monkey Inducible T-Cell Co Stimulator Ligand ELISA Kit

Sign In for Pricing
View Details
Monkey Inducible T-Cell Co Stimulator Ligand ELISA Kit
MBS080330-02 96 Well

Monkey Inducible T-Cell Co Stimulator Ligand ELISA Kit

Sign In for Pricing
View Details