Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RecombinantThymusChemokine‑1/CXCL7, Rat

Thymus Chemokine‑1, also called Chemokine (C-X-C motif) ligand 7 (CXCL7), is a member of the CXC chemokines. Similar to other ELR domain containing CXC chemokines such as IL-8 and the GRO proteins, Thymus Chemokine‑1 has been shown to bind CXCR-2 and be a chemoattractant forneutrophils and play a role in their activation. Although CTAP-III, β-TG and PBP represent amino-terminal extended variants of Thymus Chemokine‑1 and possess the same CXC chemokine domains, these proteins do not exhibit Thymus Chemokine‑1 activity. Recently, it has been shown that the additional amino-terminal residues of CTAP-III mask the critical ELR receptor binding domain that is exposed on Thymus Chemokine‑1 and may account for lack of Thymus Chemokine‑1 activity. Rat CXCL7 shares 72% amino acid sequence identity with mouse CXCL7.Recombinant rat Thymus Chemokine‑1/ CXCL7 produced in CHO cells is a polypeptide chain containing 62 amino acids. A fully biologically active molecule, rrThymus Chemokine‑1/CXCL7 has a molecular mass of 9.8 kDa analyzed by reducing SDS-PAGE and is obtained by chromatographic techniques at GenScript.

Product Specifications

CAS Number

9000-83-3

Endotoxin

< 0.2 EU/μg, determined by LAL method.

Purity

> 97% as analyzed by SDS-PAGE and HPLC.

Bioactivity

The EC50 value of rat Thymus Chemokine‑1/CXCL7 on Caˆ2+ mobilization assay in CHO-K1/Gα15/rCXCR2 cells (human Gα15 and rat CXCR2 stably expressed in CHO-K1 cells) is less than 300 ng/ml.

Reconstitution

Reconstituted in ddH2O or PBS at 100 μg/ml.

Molecular Weight

9.8 kDa, observed by reducing SDS-PAGE.

Storage Conditions

Lyophilized recombinant Rat Thymus Chemokine‑1/CXCL7 remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, Rat Thymus Chemokine‑1/CXCL7 should be stable up to 1 week at 4°C or up to 3 months at -20°C.

Appearance

Sterile Filtered White lyophilized (freeze-dried) powder.

Formulation

Lyophilized after extensive dialysis against PBS.

Host or Source

CHO

Recommended Usage

This material is offered by USA Bioworld biotech for research, laboratory or further evaluation purposes. For research use only.

AA Sequence

IELRCRCTNTLSGIPLNSISRVNVFRPGAHCDNVEVIATLKNGKEVCLDPTAPMIKKIVKKI

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

NFYC (NM_014223) Human Tagged ORF Clone
RG200060 10 µg

NFYC (NM_014223) Human Tagged ORF Clone

Sign In for Pricing
View Details
Pcdha1 (NM_054072) Mouse Tagged ORF Clone
MR221390 10 µg

Pcdha1 (NM_054072) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
I79_001071 (Biotin)
565270-01 50 µg

I79_001071 (Biotin)

Sign In for Pricing
View Details
I79_001071 (Biotin)
565270-02 100 µg

I79_001071 (Biotin)

Sign In for Pricing
View Details
Bovine Soluble Lectin-Like Oxidized Low Density Lipoprotein Receptor-1 ELISA Kit
MBS029318-01 48 Well

Bovine Soluble Lectin-Like Oxidized Low Density Lipoprotein Receptor-1 ELISA Kit

Sign In for Pricing
View Details
Bovine Soluble Lectin-Like Oxidized Low Density Lipoprotein Receptor-1 ELISA Kit
MBS029318-02 96 Well

Bovine Soluble Lectin-Like Oxidized Low Density Lipoprotein Receptor-1 ELISA Kit

Sign In for Pricing
View Details