Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RecombinantTGF-α, Human

Protransforming Growth Factor-alpha (TGF-alpha), also known as sarcoma growth factor, TGF-type I and ETGF, is a member of the EGF family of cytokines. It is expressed in monocytes, brain cells, keratinocytes and various tumor cells. ProTGF-alpha signals through EGFR and acts synergistically with TGF-beta to promote the proliferation of a wide range of epidermal and epithelial cells. It may function as either a membrane-bound ligand or a soluble ligand. Membrane-bound proTGF-alpha plays a role in cell-cell adhesion and juxtacrine stimulation of adjacent cells. The soluble form of the cytokine is released from the membrane-bound form by proteolytic cleavage and acts as a mitogen for cell proliferation.

Product Specifications

CAS Number

9000-83-3

Endotoxin

< 0.2 EU/μg, determined by LAL method.

Purity

> 95% as analyzed by SDS-PAGE and HPLC.

Bioactivity

ED50 < 0.4 ng/ml, measured in a cell proliferation assay using 3T3 cells.

Reconstitution

Reconstituted in ddH2O or PBS at 100 μg/ml.

Molecular Weight

8-10 kDa, observed by reducing SDS-PAGE.

Storage Conditions

Lyophilized recombinant Human TGF-alpha remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, Human TGF-alpha Receptor should be stable up to 1 week at 4°C or up to 2 months at -20°C.

Appearance

Sterile Filtered White lyophilized (freeze-dried) powder.

Formulation

Lyophilized after extensive dialysis against PBS.

Host or Source

CHO

Recommended Usage

This material is offered by USA Bioworld biotech for research, laboratory or further evaluation purposes. For research use only.

AA Sequence

VVSHFNDCPDSHTQFCFHGTCRFLVQEDKPACVCHSGYVGARCEHADLLA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CDC6 Antibody
orb1315487-01 30 µL

CDC6 Antibody

Sign In for Pricing
View Details
CDC6 Antibody
orb1315487-02 50 μL

CDC6 Antibody

Sign In for Pricing
View Details
CDC6 Antibody
orb1315487-03 100 µL

CDC6 Antibody

Sign In for Pricing
View Details
Canine Huntingtin Associated Protein 1 ELISA Kit
MBS106668-01 48 Well

Canine Huntingtin Associated Protein 1 ELISA Kit

Sign In for Pricing
View Details
Canine Huntingtin Associated Protein 1 ELISA Kit
MBS106668-02 96 Well

Canine Huntingtin Associated Protein 1 ELISA Kit

Sign In for Pricing
View Details
Canine Huntingtin Associated Protein 1 ELISA Kit
MBS106668-03 5x 96 Well

Canine Huntingtin Associated Protein 1 ELISA Kit

Sign In for Pricing
View Details