RecombinantTGF-α, Human
Protransforming Growth Factor-alpha (TGF-alpha), also known as sarcoma growth factor, TGF-type I and ETGF, is a member of the EGF family of cytokines. It is expressed in monocytes, brain cells, keratinocytes and various tumor cells. ProTGF-alpha signals through EGFR and acts synergistically with TGF-beta to promote the proliferation of a wide range of epidermal and epithelial cells. It may function as either a membrane-bound ligand or a soluble ligand. Membrane-bound proTGF-alpha plays a role in cell-cell adhesion and juxtacrine stimulation of adjacent cells. The soluble form of the cytokine is released from the membrane-bound form by proteolytic cleavage and acts as a mitogen for cell proliferation.
Product Specifications
CAS Number
9000-83-3
Endotoxin
< 0.2 EU/μg, determined by LAL method.
Purity
> 95% as analyzed by SDS-PAGE and HPLC.
Bioactivity
ED50 < 0.4 ng/ml, measured in a cell proliferation assay using 3T3 cells.
Reconstitution
Reconstituted in ddH2O or PBS at 100 μg/ml.
Molecular Weight
8-10 kDa, observed by reducing SDS-PAGE.
Storage Conditions
Appearance
Sterile Filtered White lyophilized (freeze-dried) powder.
Formulation
Lyophilized after extensive dialysis against PBS.
Host or Source
CHO
Recommended Usage
This material is offered by USA Bioworld biotech for research, laboratory or further evaluation purposes. For research use only.
AA Sequence
VVSHFNDCPDSHTQFCFHGTCRFLVQEDKPACVCHSGYVGARCEHADLLA
Available Sizes
Frequently Asked Questions
Explore Other Products
Browse additional items from our catalog
Lentiviral mouse Cst10 shRNA (UAS) - Lentiviral mouse Cst10 shRNA (UAS, iRFP) (25)
