Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RecombinantSDF-1α/CXCL12, Mouse

SDF-1 α and SDF-1 β, members of the chemokine α subfamily that lack the ELR domain, were initially identified using the signal sequence trap cloning strategy from a mouse bone-marrow stromal cell line. SDF-1 α and SDF-1 β cDNAs encode precursor proteins of 89 and 93 amino acid residues, respectively. Both SDF-1 α and SDF-1 β are encoded by a single gene and arise by alternative splicing. The two proteins are identical except for the four amino acid residues that are present in the carboxy-terminus of SDF-1 β and absent from SDF-1 α. SDF-1/PBSF is highly conserved between species, with only one amino acid substitution between the mature human and mouse proteins. SDF-1/PBSF acts via the chemokine receptor CXCR4 and has been shown to be a chemoattractant for T-lymphocytes, monocytes, pro- and pre-B cells, but not neutrophils. Mice lacking SDF-1 or CXCR4 have been found to have impaired B-lymphopoiesis, myelopoiesis, vascular development, cardiogenesis and abnormal neuronal cell migration and patterning in the central nervous system.Recombinant Mouse SDF-1 α/CXCL12 produced in CHO cells is a polypeptide chain containing 68 amino acids. A fully biologically active molecule, rm SDF-1 β/CXCL12 has a molecular mass of 8 kDa analyzed by reducing SDS-PAGE and is obtained by chromatographic techniques at GenScript.

Product Specifications

CAS Number

9000-83-3

Endotoxin

< 0.2 EU/μg, determined by LAL method.

Purity

> 95% as analyzed by SDS-PAGE.

Bioactivity

The EC50 value of mouse SDF-1 α/CXCL12 on Caˆ2+ mobilization assay in CHO-K1/Gα15/mCXCR4 cells (human Gα15 and mCXCR4 stably expressed in CHO-K1 cells) is less than 1.5 μg/ml.

Reconstitution

Reconstituted in ddH2O or PBS at 100 μg/ml.

Molecular Weight

8 kDa, observed by reducing SDS-PAGE.

Storage Conditions

Lyophilized recombinant Mouse SDF‑1 α/CXCL12 remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, Mouse SDF‑1 α/CXCL12 should be stable up to 1 week at 4°C or up to 3 months at -20°C.

Appearance

Sterile Filtered White lyophilized (freeze-dried) powder.

Formulation

Lyophilized after extensive dialysis against PBS.

Host or Source

CHO

Recommended Usage

This material is offered by USA Bioworld biotech for research, laboratory or further evaluation purposes. For research use only.

AA Sequence

KPVSLSYRCPCRFFESHIARANVKHLKILNTPNCALQIVARLKNNNRQVCIDPKLKWIQEYLEKALNK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

1,1-Diethoxy-2-methylpropan-2-ol
IEA99455-01 50 mg

1,1-Diethoxy-2-methylpropan-2-ol

Sign In for Pricing
View Details
1,1-Diethoxy-2-methylpropan-2-ol
IEA99455-02 0.5 g

1,1-Diethoxy-2-methylpropan-2-ol

Sign In for Pricing
View Details
Lenalidomide
S1029-10mg 10 mg

Lenalidomide

Sign In for Pricing
View Details
CD68 Polyclonal Antibody
MBS2572378-01 0.06 mL

CD68 Polyclonal Antibody

Sign In for Pricing
View Details
CD68 Polyclonal Antibody
MBS2572378-02 0.12 mL

CD68 Polyclonal Antibody

Sign In for Pricing
View Details
CD68 Polyclonal Antibody
MBS2572378-03 0.2 mL

CD68 Polyclonal Antibody

Sign In for Pricing
View Details