Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RecombinantPDGF-DD, Human

PDGF-DD, also known as platelet-derived growth factor D, IEGF and SCDGFB, is asecreted growth factor belonging to the PDGF/VEGFfamily. It is highly expressed in the heart, pancreas, adrenal glands and ovary. PDGF-DD forms functional homodimers that bind and induce PDGF Rβ homodimers and PDGF Rα/β heterodimers that promote intracellular signaling. This plays an important role in the regulation of cell differentiation, migration and survival. It has also been reported that PDGF-DD can induce monocyte and macrophage recruitment, increase interstitial pressure and facilitate wound healing.

Product Specifications

CAS Number

9000-83-3

Endotoxin

< 0.2 EU/μg, determined by LAL method.

Purity

> 95% as analyzed by SDS-PAGE.

Bioactivity

ED50 < 5 μg/ml, measured in a cell proliferation assay using 3T3 cells.

Reconstitution

Reconstituted in ddH2O or PBS at 100 μg/ml.

Molecular Weight

19-21 kDa, observed by reducing SDS-PAGE.

Storage Conditions

Lyophilized recombinant human PDGF-DD remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, human PDGF-DDshould be stable up to 1 week at 4°C or up to 2 months at -20°C.

Appearance

Sterile Filtered White lyophilized (freeze-dried) powder.

Formulation

Lyophilized after extensive dialysis against PBS.

Host or Source

CHO

Recommended Usage

This material is offered by USA Bioworld biotech for research, laboratory or further evaluation purposes. For research use only.

AA Sequence

SYHDRKSKVDLDRLNDDAKRYSCTPRNYSVNIREELKLANVVFFPRCLLVQRCGGNCGCGTVNWRSCTCNSGKTVKKYHE VLQFEPGHIKRRGRAKTMALVDIQLDHHERCDCICSSRPPR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

T-complex Protein 1 beta (T-complex Protein 1 beta Subunit, TCP1 beta, TCP-1 beta, 99D8.1, Chaperonin Containing T-complex Polypeptide 1 beta Subunit, CCT beta, CCT-beta, CCTB, Chaperonin Containing TCP1 Subunit 2 (beta), CCT2, MGC142074, MGC142076, PRO1633) (MaxLight 750) discontinued
T2035-10C-ML750 100 µL

T-complex Protein 1 beta (T-complex Protein 1 beta Subunit, TCP1 beta, TCP-1 beta, 99D8.1, Chaperonin Containing T-complex Polypeptide 1 beta Subunit, CCT beta, CCT-beta, CCTB, Chaperonin Containing TCP1 Subunit 2 (beta), CCT2, MGC142074, MGC142076, PRO1633) (MaxLight 750) discontinued

Sign In for Pricing
View Details
Recombinant Sulfurimonas denitrificans Acetylglutamate kinase (argB)
MBS1336128-01 0.05 mg (E-Coli)

Recombinant Sulfurimonas denitrificans Acetylglutamate kinase (argB)

Sign In for Pricing
View Details
Recombinant Sulfurimonas denitrificans Acetylglutamate kinase (argB)
MBS1336128-02 0.05 mg (Yeast)

Recombinant Sulfurimonas denitrificans Acetylglutamate kinase (argB)

Sign In for Pricing
View Details
Recombinant Sulfurimonas denitrificans Acetylglutamate kinase (argB)
MBS1336128-03 0.2 mg (E-Coli)

Recombinant Sulfurimonas denitrificans Acetylglutamate kinase (argB)

Sign In for Pricing
View Details
Recombinant Sulfurimonas denitrificans Acetylglutamate kinase (argB)
MBS1336128-04 0.05 mg (Baculovirus)

Recombinant Sulfurimonas denitrificans Acetylglutamate kinase (argB)

Sign In for Pricing
View Details
Recombinant Sulfurimonas denitrificans Acetylglutamate kinase (argB)
MBS1336128-05 0.5 mg (E-Coli)

Recombinant Sulfurimonas denitrificans Acetylglutamate kinase (argB)

Sign In for Pricing
View Details