Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RecombinantNoggin, Human (CHO-expressed)

Noggin, also known as NOG, is a homodimeric glycoprotein that bindsto and modulates the activity of TGF-beta family ligands. It is expressed in condensing cartilage and immature chondrocytes. Noggin antagonizes bone morphogenetic protein (BMP) activities by blocking epitopes on BMPs needed for binding to their receptors. Noggin has been shown to be involved in many developmental processes, such as neural tube formation and joint formation. During development, Noggin diffuses through extracellular matrices and forms morphogenic gradients, regulating cellular responses dependent on the local concentration of the signaling molecule.

Product Specifications

CAS Number

9000-83-3

Endotoxin

<0.2 EU/μg, determined by LAL method.

Purity

> 95% as analyzed by SDS-PAGE.

Bioactivity

ED50<2.5 ng/ml, measured in a bioassay using ATDC5 cells in the presence of 10ng/ml human BMP-4.

Reconstitution

Reconstituted in ddH2O or PBS at 100 μg/ml.

Molecular Weight

29-31kDa, observed by reducing SDS-PAGE.

Storage Conditions

Lyophilized recombinant human Noggin remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, human Nogginshould be stable up to 1 week at 4°C or up to 2 months at -20°C.

Appearance

Sterile Filtered White lyophilized (freeze-dried) powder.

Formulation

Lyophilized after extensive dialysis against PBS.

Host or Source

CHO

Recommended Usage

This material is offered by USA Bioworld biotech for research, laboratory or further evaluation purposes. For research use only.

AA Sequence

QHYLHIRPAPSDNLPLVDLIEHPDPIFDPKEKDLNETLLRSLLGGHYDPGFMATSPPEDR PGGGGGAAGGAEDLAELDQLLRQRPSGAMPSEIKGLEFSEGLAQGKKQRLSKKLRRKLQM WLWSQTFCPVLYAWNDLGSRFWPRYVKVGSCFSKRSCSVPEGMVCKPSKSVHLTVLRWRC QRRGGQRCGWIPIQYPIISECKCSC

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

MANF Rabbit Polyclonal Antibody
E53P09212 100 µL

MANF Rabbit Polyclonal Antibody

Ask
View Details
Human Potassium voltage-gated channel subfamily E member 1-like protein (KCNE1L) ELISA Kit
MBS282519-01 48 Tests

Human Potassium voltage-gated channel subfamily E member 1-like protein (KCNE1L) ELISA Kit

Ask
View Details
Human Potassium voltage-gated channel subfamily E member 1-like protein (KCNE1L) ELISA Kit
MBS282519-02 96 Tests

Human Potassium voltage-gated channel subfamily E member 1-like protein (KCNE1L) ELISA Kit

Ask
View Details
Human Potassium voltage-gated channel subfamily E member 1-like protein (KCNE1L) ELISA Kit
MBS282519-03 5x 96 Tests

Human Potassium voltage-gated channel subfamily E member 1-like protein (KCNE1L) ELISA Kit

Ask
View Details
Human Potassium voltage-gated channel subfamily E member 1-like protein (KCNE1L) ELISA Kit
MBS282519-04 10x 96 Tests

Human Potassium voltage-gated channel subfamily E member 1-like protein (KCNE1L) ELISA Kit

Ask
View Details
U2AF2 Recombinant Antibody, AbBy Fluor™ 405 Conjugated
bsm-62036R-BF405-01 20 µL

U2AF2 Recombinant Antibody, AbBy Fluor™ 405 Conjugated

Ask
View Details