Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RecombinantMPIF-1/CCL23, Human

Myeloid progenitor inhibitory factor 1 (MPIF-1), also known as Chemokine (C-C motif) ligand 23 (CCL23) is a small cytokine belonging to the CC chemokine family.MPIF-1is predominantly expressed in lung and liver tissue, but is also found in bone marrow and placenta. It is also expressed in some cell lines of myeloid origin. It is highly chemotactic for resting T cells and monocytes and slightly chemotactic for neutrophils. MPIF-1 has been shown to inhibit colony formation of bone marrow myeloid immature progenitors. It has also been attributed to an inhibitory activity on hematopoietic progenitor cells. MPIF-1 is a ligand for the chemokine receptor CCR1.Recombinant human MPIF-1/CCL23 produced in CHO cells is a single polypeptide chain containing 99 amino acids. A fully biologically active molecule, rhMPIF-1/CCL23 has a molecular mass of 12 kDa analyzed by reducing SDS-PAGE and is obtained by chromatographic techniques at GenScript.

Product Specifications

CAS Number

9000-83-3

Endotoxin

< 0.2 EU/μg, determined by LAL method.

Purity

> 98% as analyzed by SDS-PAGE.

Bioactivity

The EC50 value of human MPIF-1/CCL23 on Caˆ2+ mobilization assay in CHO-K1/Ga15/hCCR1 cells (human Ga15 and human CCR1 stably expressed in CHO-K1 cells) is less than 2 μg/ml.

Reconstitution

Reconstituted in ddH2O or PBS at 100 μg/ml.

Molecular Weight

12 kDa, observed by reducing SDS-PAGE.

Storage Conditions

Lyophilized recombinant humanMPIF-1/CCL23 remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, human MPIF-1/CCL23 should be stable up to 1 week at 4°C or up to 2 months at -20°C.

Appearance

Sterile Filtered White lyophilized (freeze-dried) powder.

Formulation

Lyophilized after extensive dialysis against PBS.

Host or Source

CHO

Recommended Usage

This material is offered by USA Bioworld biotech for research, laboratory or further evaluation purposes. For research use only.

AA Sequence

RVTKDAETEFMMSKLPLENPVLLDRFHATSADCCISYTPRSIPCSLLESYFETNSECSKP GVIFLTKKGRRFCANPSDKQVQVCVRMLKLDTRIKTRKN

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Mouse β-Thromboglobulin,β-TG ELISA Kit
CN-02813M2 48T

Mouse β-Thromboglobulin,β-TG ELISA Kit

Ask
View Details
Benzyl (2- (2- (2-aminoethoxy) ethoxy) ethyl) carbamate
OR1005603-01 250 mg

Benzyl (2- (2- (2-aminoethoxy) ethoxy) ethyl) carbamate

Ask
View Details
Benzyl (2- (2- (2-aminoethoxy) ethoxy) ethyl) carbamate
OR1005603-02 1 g

Benzyl (2- (2- (2-aminoethoxy) ethoxy) ethyl) carbamate

Ask
View Details
Benzyl (2- (2- (2-aminoethoxy) ethoxy) ethyl) carbamate
OR1005603-03 5 g

Benzyl (2- (2- (2-aminoethoxy) ethoxy) ethyl) carbamate

Ask
View Details
Benzyl (2- (2- (2-aminoethoxy) ethoxy) ethyl) carbamate
OR1005603-04 10 g

Benzyl (2- (2- (2-aminoethoxy) ethoxy) ethyl) carbamate

Ask
View Details
Lck Peptide
AF6101-BP 1 mg

Lck Peptide

Ask
View Details