Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RecombinantMIP-1α/CCL3, Human (CHO-expressed)

MIP-1 Alpha, also known as CCL3, G0S19-1 and SCYA3, is a small inducible monokine belonging to the intercrine beta (chemokine CC) family. It binds to CCR1, CCR4 and CCR5, and participates in the host response to invading pathogens by regulating the trafficking and activation of inflammatory cells, such as macrophages, lymphocytes, NK cells and dendritic cells. MIP-1 alpha polymorphisms are associated with HIV susceptibility or resistance. Recombinant MIP-1 alpha induces a dose-dependent inhibition of HIV and SIV infection.

Product Specifications

CAS Number

9000-83-3

Endotoxin

< 0.2 EU/μg, determined by LAL method.

Purity

> 95% as analyzed by SDS-PAGE and HPLC.

Bioactivity

ED50 < 100 ng/ml, measured in a calcium flux assay using CHO/Gα15 cells expressing CCR5.

Reconstitution

Reconstituted in ddH2O or PBS at 100 μg/ml.

Molecular Weight

8-10 kDa, observed by reducing SDS-PAGE.

Storage Conditions

Lyophilized recombinant Human MIP-1 Alpha remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, Human MIP-1 Alpha should be stable up to 1 week at 4°C or up to 2 months at -20°C.

Appearance

Sterile Filtered White lyophilized (freeze-dried) powder.

Formulation

Lyophilized after extensive dialysis against PBS.

Host or Source

CHO

Recommended Usage

This material is offered by USA Bioworld biotech for research, laboratory or further evaluation purposes. For research use only.

AA Sequence

ADTPTACCFSYTSRQIPQNFIADYFETSSQCSKPGVIFLTKRSRQVCADPSEEWVQKYVSDLELSA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
TA50011-30 30 µL

Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody

Sign In for Pricing
View Details
L-Cysteinylglycine
TRC-C994770-50MG 50 mg

L-Cysteinylglycine

Sign In for Pricing
View Details
TNFS15 / VEGI (Vascular Endothelial Growth Inhibitor) (VEGI/2052R), CF405S conjugate, 0.1mg/mL
BNC042052-100 1x 100 µL

TNFS15 / VEGI (Vascular Endothelial Growth Inhibitor) (VEGI/2052R), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
OSMR Goat Polyclonal Antibody
AP32054PU-N 100 µg

OSMR Goat Polyclonal Antibody

Sign In for Pricing
View Details
O,O-Diethyl Dithiophosphate Ammonium Salt
TRC-D444265-5G 5 g

O,O-Diethyl Dithiophosphate Ammonium Salt

Sign In for Pricing
View Details
OR6C2 Human qPCR Primer Pair (NM_054105)
HP216619 200 Reactions

OR6C2 Human qPCR Primer Pair (NM_054105)

Sign In for Pricing
View Details