Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RecombinantM-CSF, Rat

Macrophage-Colony Stimulating Factor (M-CSF), also known as Colony Stimulating Factor-1 (CSF-1), can stimulate the survival, proliferation and differentiation of mononuclear phagocytes, in addition to the spreading and motility of macrophages[1]. M-CSF is mainly produced by monocytes, macrophages, fibroblasts, and endothelial cells [2]. M-CSF interaction with its receptor, c-fms, has been implicated in the growth, invasion, and metastasis of of several diseases, including breast and endometrial cancers [1][3][4].

Product Specifications

CAS Number

9000-83-3

Endotoxin

< 0.2 EU/μg, determined by LAL method.

Purity

> 95% as analyzed by SDS-PAGE.

Bioactivity

ED50 < 2.5 ng/ml, measured in a cell proliferation assay using Murine M-NFS-60 cells, corresponding to a specific activity of > 4x10ˆ5 units/mg.

Reconstitution

Reconstituted in ddH2O or PBS at 100 μg/ml.

Molecular Weight

32-40 kDa, observed by non-reducing SDS-PAGE.

Storage Conditions

Lyophilized recombinant Rat Macrophage-Colony Stimulating Factor (M-CSF) remains stable up to 6 months at -80 °C from date of receipt. Upon reconstitution, rrM-CSF should be stable up to 1 week at 4 °C or up to 2 months at -20 °C.

Appearance

Sterile Filtered White lyophilized (freeze-dried) powder.

Formulation

Lyophilized after extensive dialysis against PBS.

Host or Source

CHO

Recommended Usage

This material is offered by USA Bioworld biotech for research, laboratory or further evaluation purposes. For research use only.

AA Sequence

EVSEHCSHMIGNGHLQILQQLIDSQMETACLIEYKFVDQEQLDDPVCYLKKAFVLVQVIIEETMRFKDNTPNANATERLQ ELSMKLNSCFIKDYKEQNEACVQTYKESPLRLLEKIKNFFNETKNFLEKDWNIFSKNCNDSLAKCSSRDVVTKP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DL-Thiorphan
4010438.0025 25 mg

DL-Thiorphan

Sign In for Pricing
View Details
3-[ (Propan-2-ylsulfanyl) methyl]aniline
DXB43080-01 50 mg

3-[ (Propan-2-ylsulfanyl) methyl]aniline

Sign In for Pricing
View Details
3-[ (Propan-2-ylsulfanyl) methyl]aniline
DXB43080-02 0.5 g

3-[ (Propan-2-ylsulfanyl) methyl]aniline

Sign In for Pricing
View Details
Recombinant Myosin VIIB (MYO7B)
TRV-0010019-01 10 µg

Recombinant Myosin VIIB (MYO7B)

Sign In for Pricing
View Details
Recombinant Myosin VIIB (MYO7B)
TRV-0010019-02 50 µg

Recombinant Myosin VIIB (MYO7B)

Sign In for Pricing
View Details
Recombinant Myosin VIIB (MYO7B)
TRV-0010019-03 100 µg

Recombinant Myosin VIIB (MYO7B)

Sign In for Pricing
View Details