Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RecombinantMCP‑3/MARC/CCL7, Mouse

Chemokine (C-C motif) ligand 7 (CCL7) is a small cytokine that was previously called monocyte-specific chemokine 3 (MCP-3) . Due to CCL7 possessing two adjacent N-terminal cysteine residues in its mature form, it is classified within the subfamily of chemokines known as CC chemokines. CCL7 specifically attracts monocytes, and regulates macrophage function. It is produced by certain tumor cell lines and by macrophages. This chemokine is located on chromosome 17 in humans, within a large cluster containing many other CC chemokines and is most closely related to CCL2. CCL7 can signal through the CCR1, CCR2 and CCR3 receptors.Recombinant Mouse MCP‑3/MARC/CCL7 produced in CHO cells is a polypeptide chain containing 74 amino acids. A fully biologically active molecule, rmMCP 3/CCL7 has a molecular mass of 8-12 kDa analyzed by reducing SDS-PAGE and is obtained by chromatographic techniques at GenScript.

Product Specifications

CAS Number

9000-83-3

Endotoxin

< 0.2 EU/μg, determined by LAL method.

Purity

> 98% as analyzed by SDS-PAGE.

Bioactivity

The EC50 value of mouse MCP 3 MARC/CCL7 on Caˆ2+ mobilization assay in CHO-K1/ Gα15/mCCR2 cells (human Gα15 and mouse CCR2 stably expressed in CHO-K1 cells) is less than 1 μg/ml.

Reconstitution

Reconstituted in ddH2O or PBS at 100 μg/ml.

Molecular Weight

8~12 kDa, observed by reducing SDS-PAGE.

Storage Conditions

Lyophilized recombinant Mouse MCP‑3/MARC/CCL7 remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, Mouse MCP‑3/MARC/CCL7 should be stable up to 1 week at 4°C or up to 3 months at -20°C.

Appearance

Sterile Filtered White lyophilized (freeze-dried) powder.

Formulation

Lyophilized after extensive dialysis against PBS.

Host or Source

CHO

Recommended Usage

This material is offered by USA Bioworld biotech for research, laboratory or further evaluation purposes. For research use only.

AA Sequence

QPDGPNASTCCYVKKQKIPKRNLKSYRRITSSRCPWEAVIFKTKKGMEVCAEAHQKWVEE AIAYLDMKTPTPKP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Endostatin Polyclonal Antibody, AbBy Fluor™ 488 Conjugated
bs-25244R-BF488 100 µL

Endostatin Polyclonal Antibody, AbBy Fluor™ 488 Conjugated

Sign In for Pricing
View Details
PPP5C Antibody
GWB-MU468I 50 µg

PPP5C Antibody

Sign In for Pricing
View Details
TSPO Antibody - C-terminal region
MBS3220770-01 0.1 mL

TSPO Antibody - C-terminal region

Sign In for Pricing
View Details
TSPO Antibody - C-terminal region
MBS3220770-02 5x 0.1 mL

TSPO Antibody - C-terminal region

Sign In for Pricing
View Details
Apc11 (ANAPC11) (NM_001002246) Human Tagged ORF Clone Lentiviral Particle
RC224653L4V 200 µL

Apc11 (ANAPC11) (NM_001002246) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
XRCC6 Polyclonal Antibody, Biotin Conjugated
A56650-050 50 µL

XRCC6 Polyclonal Antibody, Biotin Conjugated

Sign In for Pricing
View Details