Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RecombinantIL-9, Human

Interleukin 9, also known as IL9, is a cytokine (cell signalling molecule) belonging to the group of interleukins. The protein encoded by this gene is a cytokine produced by T-cells and specifically by CD4+ helper cells that acts as a regulator of a variety of hematopoietic cells. This cytokine stimulates cell proliferation and prevents apoptosis. It functions through the interleukin-9 receptor (IL9R), which activates different signal transducer and activator (STAT) proteins and thus connects this cytokine to various biological processes. The gene encoding this cytokine has been identified as a candidate gene for asthma. Genetic studies on a mouse model of asthma demonstrated that this cytokine is a determining factor in the pathogenesis of bronchial hyperresponsiveness.

Product Specifications

CAS Number

9000-83-3

Endotoxin

< 0.2 EU/μg, determined by LAL method.

Purity

> 95% as analyzed by SDS-PAGE and HPLC.

Bioactivity

ED50 < 1 ng/ml, measured in a cell proliferation assay using MO7e cells, corresponding to a specific activity of > 1x10ˆ6 units/mg.

Reconstitution

Reconstituted in ddH2O or PBS at 100 μg/ml.

Molecular Weight

25-40 kDa, observed by non-reducing SDS-PAGE.

Storage Conditions

Lyophilized recombinant human Interlerkin 9 (IL-9) remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, rhIL-9 should be stable up to 1 week at 4°C or up to 2 months at -20°C.

Appearance

Sterile Filtered White lyophilized (freeze-dried) powder.

Formulation

Lyophilized after extensive dialysis against PBS.

Host or Source

CHO

Recommended Usage

This material is offered by USA Bioworld biotech for research, laboratory or further evaluation purposes. For research use only.

AA Sequence

QGCPTLAGILDINFLINKMQEDPASKCHCSANVTSCLCLGIPSDNCTRPCFSERLSQMTNTTMQTRYPLIFSRVKKSVEV LKNNKCPYFSCEQPCNQTTAGNALTFLKSLLEIFQKEKMRGMRGKI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Neurotensin (NTS) ELISA Kit
abx155887-01 96 Tests

Rat Neurotensin (NTS) ELISA Kit

Sign In for Pricing
View Details
Rat Neurotensin (NTS) ELISA Kit
abx155887-02 5x 96 Tests

Rat Neurotensin (NTS) ELISA Kit

Sign In for Pricing
View Details
Rat Neurotensin (NTS) ELISA Kit
abx155887-03 10x 96 Tests

Rat Neurotensin (NTS) ELISA Kit

Sign In for Pricing
View Details
Mouse Monoclonal Bovine Serum Albumin Antibody (ALB/398) [Biotin]
NBP2-76991B 0.1 mL

Mouse Monoclonal Bovine Serum Albumin Antibody (ALB/398) [Biotin]

Sign In for Pricing
View Details
CD3 (Biotin) discontinued
C2253-37J-Biotin 100 µL

CD3 (Biotin) discontinued

Sign In for Pricing
View Details
PIRC109 Recombinant Protein (Human)
RP083364 100 µg

PIRC109 Recombinant Protein (Human)

Sign In for Pricing
View Details