Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RecombinantIL-8/CXCL8 (8-79aa), Human (CHO-expressed)

Interleukin-8 (IL-8), also known as CXCL8, GCP-1 and NAP-1, is a proinflammatory chemokine belonging to the intercrine alpha (chemokine CXC) family. It is secreted by monocytes, macrophages and endothelial cells. IL-8 signals through CXCR1 and CXCR2 to chemoattract neutrophils, basophils, and T cells. IL-8 is also a potent promoter of angiogenesis. Other functions of this protein, such as involvement in bronchiolitis pathogenesis, have also been reported.

Product Specifications

CAS Number

9000-83-3

Endotoxin

< 0.2 EU/μg, determined by LAL method.

Purity

> 95% as analyzed by SDS-PAGE and HPLC.

Bioactivity

ED50 < 6 ng/ml, measured in a calcium flux assay using CHO/Gα15 cells transiently expressing CXCR1.

Reconstitution

Reconstituted in ddH2O or PBS at 100 μg/ml.

Molecular Weight

~9 kDa, observed by reducing SDS-PAGE

Storage Conditions

Lyophilized recombinant Human Interleukin-8 remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, Human Interleukin-8 should be stable up to 1 week at 4°C or up to 2 months at -20°C.

Appearance

Sterile Filtered White lyophilized (freeze-dried) powder.

Formulation

Lyophilized after extensive dialysis against PBS.

Host or Source

CHO

Recommended Usage

This material is offered by USA Bioworld biotech for research, laboratory or further evaluation purposes. For research use only.

AA Sequence

AVLPRSAKELRCQCIKTYSKPFHPKFIKELRVIESGPHCANTEIIVKLSDGRELCLDPKENWVQRVVEKFLKRAENS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue FFPE Sections, Cervix
CS809128 5x 5 µm

Tissue FFPE Sections, Cervix

Sign In for Pricing
View Details
p53R2 (RRM2B) (NM_001172477) Human Over-expression Lysate
LY433055 100 µg

p53R2 (RRM2B) (NM_001172477) Human Over-expression Lysate

Sign In for Pricing
View Details
Pebp1 Rabbit Polyclonal Antibody
AP08722SU-N 100 µL

Pebp1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Tocofersolan
TRC-T526075-25G 25 g

Tocofersolan

Sign In for Pricing
View Details
Traip Mouse Gene Knockout Kit (CRISPR)
KN518132 1 Kit

Traip Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Rcl1 Mouse Gene Knockout Kit (CRISPR)
KN514613 1 Kit

Rcl1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details