Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RecombinantIL-7, His, Rat

Interleukin-7 (IL-7), also known as lymphopoietin 1 and pre-B cell factor, is a hematopoietic growth factor belonging to the IL-7/IL-9 family. It is produced by keratinocytes, dendritic cells, hepatocytes, neurons and epithelial cells. IL-7 binds and signals through IL-7 receptor, a heterodimer consisting of IL-7 receptor alpha and common gamma chain receptor. IL-7 plays a role in regulating early B cell and T cell development. It is also important for optimal dendritic cell-T cell interaction.

Product Specifications

CAS Number

9000-83-3

Endotoxin

< 0.2 EU/μg, determined by LAL method.

Purity

> 95% as analyzed by SDS-PAGE.

Bioactivity

ED50 < 22 ng /ml, measured in a cell proliferation assay using 2E8 cells.

Reconstitution

Reconstituted in ddH2O or PBS at 100 μg/ml.

Molecular Weight

20-28 kDa, observed by reducing SDS-PAGE.

Storage Conditions

Lyophilized recombinant rat Interleukin-7 (IL-7), His remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, rat Interleukin-7 (IL-7), His should be stable up to 1 week at 4°C or up to 2 months at -20°C.

Appearance

Sterile Filtered White lyophilized (freeze-dried) powder.

Formulation

Lyophilized after extensive dialysis against PBS.

Host or Source

CHO

Recommended Usage

This material is offered by USA Bioworld biotech for research, laboratory or further evaluation purposes. For research use only.

AA Sequence

DCHIKDKDGKAFGSVLMISINQLDKMTGTDSDCPNNEPNFFKKHLCDDTKEAAFLNRAARKLRQFLKMNISEEFNDHLLR VSDGTQTLVNCTSKEEKTIKEQKKNDPCFLKRLLREIKTCWNKILKGSIHHHHHH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

P62/SQSTM1 Rabbit mAb
56089 50 µL

P62/SQSTM1 Rabbit mAb

Sign In for Pricing
View Details
IGF1R (Phospho-Tyr1346) Antibody
orb191567-01 50 μL

IGF1R (Phospho-Tyr1346) Antibody

Sign In for Pricing
View Details
IGF1R (Phospho-Tyr1346) Antibody
orb191567-02 100 µL

IGF1R (Phospho-Tyr1346) Antibody

Sign In for Pricing
View Details
Anti-CISD2 Antibody Picoband®, APC Conjugate
A06387-1-APC 100 µg/Vial

Anti-CISD2 Antibody Picoband®, APC Conjugate

Sign In for Pricing
View Details
SPEF2 Protein Vector (Mouse) (pPB-N-His)
PV233243 500 ng

SPEF2 Protein Vector (Mouse) (pPB-N-His)

Sign In for Pricing
View Details
TYMP Peptide
DF6237-BP 1 mg

TYMP Peptide

Sign In for Pricing
View Details