Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RecombinantIL-7, His, Mouse

Interleukin-7 (IL-7), also known as lymphopoietin 1 and pre-B cell factor, is a hematopoietic growth factor belonging to the IL-7/IL-9 family. It is produced by keratinocytes, dendritic cells, hepatocytes, neurons and epithelial cells. IL-7 binds and signals through IL-7 receptor, a heterodimer consisting of IL-7 receptor alpha and common gamma chain receptor.IL-7 plays a role in regulating early B cell and T cell development. It is also important for optimal dendritic cell-T cell interaction.

Product Specifications

CAS Number

9000-83-3

Endotoxin

<0.2 EU/μg, determined by LAL method.

Purity

> 95% as analyzed by SDS-PAGE.

Bioactivity

ED50<0.4ng/ml, measured in a cell proliferation assay using 2E8 cells.

Reconstitution

Reconstituted in ddH2O or PBS at 100 μg/ml.

Molecular Weight

8-28kDa, observed by reducing SDS-PAGE.

Storage Conditions

Lyophilized recombinant murine Interleukin-7 (IL-7), His remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, murine Interleukin-7 (IL-7), His should be stable up to 1 week at 4°C or up to 2 months at -20°C.

Appearance

Sterile Filtered White lyophilized (freeze-dried) powder.

Formulation

Lyophilized after extensive dialysis against PBS.

Host or Source

CHO

Recommended Usage

This material is offered by USA Bioworld biotech for research, laboratory or further evaluation purposes. For research use only.

AA Sequence

ECHIKDKEGKAYESVLMISIDELDKMTGTDSNCPNNEPNFFRKHVCDDTKEAAFLN RAARKLKQFLKMNISEEFNVHLLTVSQGTQTLVNCTSKEEKNVKEQKKNDACFLKRLLREIKTCWNKILKGSIHHHHHH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C4orf33 CRISPR Activation Plasmid (h2)
sc-416806-ACT-2 20 µg

C4orf33 CRISPR Activation Plasmid (h2)

Sign In for Pricing
View Details
Rab6b Rat shRNA Plasmid (Locus ID 363123)
TR707305 1 Kit

Rab6b Rat shRNA Plasmid (Locus ID 363123)

Sign In for Pricing
View Details
HLA G Recombinant Antibody, AbBy Fluor™ 680 Conjugated
bsm-61409R-BF680-TR 20 µL

HLA G Recombinant Antibody, AbBy Fluor™ 680 Conjugated

Sign In for Pricing
View Details
Anti-CXCL8 (adakitug biosimilar) mAb
12-90047-100 100 µg

Anti-CXCL8 (adakitug biosimilar) mAb

Sign In for Pricing
View Details
Osteopontin Recombinant Antibody, AbBy Fluor™ 555 Conjugated
bsm-43600R-BF555-TR 20 µL

Osteopontin Recombinant Antibody, AbBy Fluor™ 555 Conjugated

Sign In for Pricing
View Details
Mx1/2/3 (C-1)
sc-166412 200 µg/mL

Mx1/2/3 (C-1)

Sign In for Pricing
View Details