Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RecombinantIL-7, His, Human (CHO-expressed)

Interleukin-7 (IL-7), also known as lymphopoietin 1 and pre-B cell factor, is a hematopoietic growth factor belonging to the IL-7/IL-9 family. It is produced by keratinocytes, dendritic cells, hepatocytes, neurons and epithelial cells. IL-7 binds and signals through IL-7 receptor, a heterodimer consisting of IL-7 receptor alpha and common gamma chain receptor. IL-7 plays a role in regulating early B cell and T cell development. It is also important for optimal dendritic cell-T cell interaction.

Product Specifications

CAS Number

9000-83-3

Endotoxin

< 0.2 EU/μg, determined by LAL method.

Purity

> 95% as analyzed by SDS-PAGE.

Bioactivity

ED50 <0.2ng /ml, measured in a cell proliferation assay using 2E8 cells.

Reconstitution

Reconstituted in ddH2O or PBS at 100 μg/ml.

Molecular Weight

24-34 kDa, observed by reducing SDS-PAGE.

Storage Conditions

Lyophilized recombinant human Interleukin-7 (IL-7), His remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, human Interleukin-7 (IL-7), His should be stable up to 1 week at 4°C or up to 2 months at -20°C.

Appearance

Sterile Filtered White lyophilized (freeze-dried) powder.

Formulation

Lyophilized after extensive dialysis against PBS.

Host or Source

CHO

Recommended Usage

This material is offered by USA Bioworld biotech for research, laboratory or further evaluation purposes. For research use only.

AA Sequence

DCDIEGKDGKQYESVLMVSIDQLLDSMKEIGSNCLNNEFNFFKRHICDANKEGMFLFRAARKLRQFLKMNSTGDFDLHLL KVSEGTTILLNCTGQVKGRKPAALGEAQPTKSLEENKSLKEQKKLNDLCFLKRLLQEIKTCWNKILMGTKEHHHHHHH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LYAR Blocking Peptide
MBS823408-01 1 mg

LYAR Blocking Peptide

Sign In for Pricing
View Details
LYAR Blocking Peptide
MBS823408-02 5 mg

LYAR Blocking Peptide

Sign In for Pricing
View Details
LYAR Blocking Peptide
MBS823408-03 5x 5 mg

LYAR Blocking Peptide

Sign In for Pricing
View Details
RBM5 (RNA Binding Motif Protein 5, FLJ39876, G15, H37, LUCA15, RMB5) (MaxLight 650)
MBS6229589-01 0.1 mL

RBM5 (RNA Binding Motif Protein 5, FLJ39876, G15, H37, LUCA15, RMB5) (MaxLight 650)

Sign In for Pricing
View Details
RBM5 (RNA Binding Motif Protein 5, FLJ39876, G15, H37, LUCA15, RMB5) (MaxLight 650)
MBS6229589-02 5x 0.1 mL

RBM5 (RNA Binding Motif Protein 5, FLJ39876, G15, H37, LUCA15, RMB5) (MaxLight 650)

Sign In for Pricing
View Details
ULBP1 (UL16 Binding Protein 1, RAET1I) (FITC)
MBS6451809-01 0.1 mL

ULBP1 (UL16 Binding Protein 1, RAET1I) (FITC)

Sign In for Pricing
View Details