Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RecombinantIL-6R, Human

Interleukin-6 Receptor Alpha, also known as IL-6RA, IL-6R1 and CD126, belongs to the type I cytokine receptor family. It is mainly expressed on T cells, fibroblasts and macrophages. IL-6RA couples with gp130 to form the IL-6 receptor; IL-6RA binds specifically to IL-6 and depends on gp130 to transmit signals. IL-6RA dysfunction has been correlated with the pathogenesis of many diseases, such as multiple myeloma, autoimmune diseases and prostate cancer. Soluble IL-6RA, which consists of only the extracellular domain of IL-6RA, acts as an agonist of IL-6 activity.

Product Specifications

CAS Number

9000-83-3

Endotoxin

< 0.2 EU/μg, determined by LAL method.

Purity

> 95% as analyzed by SDS-PAGE and HPLC.

Bioactivity

ED50 < 0.2 μg/ml, measured in a cell proliferation assay using M1 cells in the presence of 10 ng/ml human IL-6.

Reconstitution

Reconstituted in ddH2O or PBS at 100 μg/ml.

Molecular Weight

54-56 kDa, observed by reducing SDS-PAGE.

Storage Conditions

Lyophilized recombinant Human Interleukin-6 Receptor Alpha remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, Human Interleukin-6 Receptor Alpha should be stable up to 1 week at 4°C or up to 2 months at -20°C.

Appearance

Sterile Filtered White lyophilized (freeze-dried) powder.

Formulation

Lyophilized after extensive dialysis against PBS.

Host or Source

CHO

Recommended Usage

This material is offered by USA Bioworld biotech for research, laboratory or further evaluation purposes. For research use only.

AA Sequence

LAPRRCPAQEVARGVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRWAGMGRRLLLRSVQLHDSGNYSCYRA GRPAGTVHLLVDVPPEEPQLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLA VPEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFELRYRA ERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWSPEAMGTPWTESRSPPAENEVSTPMQALTTNKD DDNILFRDSANATSLPVQDSSSVPLP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit RELB (V-Rel Reticuloendotheliosis Viral Oncogene Homolog B) ValidElisa Kit
EK346213 96 Well

Rabbit RELB (V-Rel Reticuloendotheliosis Viral Oncogene Homolog B) ValidElisa Kit

Sign In for Pricing
View Details
Goat anti Influenza A (virions)
MBS315067-01 1 mL

Goat anti Influenza A (virions)

Sign In for Pricing
View Details
Goat anti Influenza A (virions)
MBS315067-02 5x 1 mL

Goat anti Influenza A (virions)

Sign In for Pricing
View Details
Goat Human IgG (heavy and light chains) Antibody
orb22041 10 mg

Goat Human IgG (heavy and light chains) Antibody

Sign In for Pricing
View Details
CD24-VLP, Human (HEK293)
HY-P78544-01 20 µg

CD24-VLP, Human (HEK293)

Sign In for Pricing
View Details
CD24-VLP, Human (HEK293)
HY-P78544-02 50 µg

CD24-VLP, Human (HEK293)

Sign In for Pricing
View Details