Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RecombinantIL-6, Human (CHO-expressed)

Interleukin-6 (IL-6), also known as BSF-2, CDF and IFNB2, is a pleiotropic cytokine that acts in both pro-inflammatory and anti-inflammatory responses. It is produced mainly by T cells, macrophages, monocytes, endothelial cells and muscle cells. IL-6 binds to IL-6 receptor (IL-6R) to trigger the association of IL-6R with gp130, inducing signal transduction through JAKs and STATs. The biological functions of IL-6 are diverse. It stimulates B cell differentiation and antibody production, myeloma and plasmacytoma growth, as well as nerve cell differentiation. It also acts as a myokine, produced by muscle cells in response to muscle contraction, to be released to the blood stream to help break down fats and improve insulin resistance.

Product Specifications

CAS Number

9000-83-3

Endotoxin

< 0.2 EU/μg, determined by LAL method.

Purity

> 95% as analyzed by SDS-PAGE.

Bioactivity

ED50 < 0.06 ng/ml, measured in a cell proliferation assay using 7TD1 cells.

Reconstitution

Reconstituted in ddH2O or PBS at 100 μg/ml.

Molecular Weight

21-23 kDa, observed by reducing SDS-PAGE.

Storage Conditions

Lyophilized recombinant Human Interleukin-6 remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, Human Interleukin-6 should be stable up to 1 week at 4°C or up to 2 months at -20°C.

Appearance

Sterile Filtered White lyophilized (freeze-dried) powder.

Formulation

Lyophilized after extensive dialysis against PBS.

Host or Source

CHO

Recommended Usage

This material is offered by USA Bioworld biotech for research, laboratory or further evaluation purposes. For research use only.

AA Sequence

PVPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNE ETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQD MTTHLILRSFKEFLQSSLRALRQM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Sections, Myeloid tissue
CS630622 5x 5 µm

Frozen Tissue Sections, Myeloid tissue

Sign In for Pricing
View Details
ERK2 (MAPK1) Mouse Monoclonal Antibody [Clone ID: AT1A4]
AM09368PU-N 100 µL

ERK2 (MAPK1) Mouse Monoclonal Antibody [Clone ID: AT1A4]

Sign In for Pricing
View Details
DHCR7 (NM_001360) Human Over-expression Lysate
LY419974 100 µg

DHCR7 (NM_001360) Human Over-expression Lysate

Sign In for Pricing
View Details
(4-((3-Acetamidopropyl)(tert-butoxycarbonyl)amino)butyl)(3-((tert-butoxycarbonyl)amino)propyl)carbamic Acid-d3 tert-Butyl Ester
TRC-A158572-5MG 5 mg

(4-((3-Acetamidopropyl)(tert-butoxycarbonyl)amino)butyl)(3-((tert-butoxycarbonyl)amino)propyl)carbamic Acid-d3 tert-Butyl Ester

Sign In for Pricing
View Details
SH2D7 Human Gene Knockout Kit (CRISPR)
KN425742 1 Kit

SH2D7 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
TMEM87A Human Gene Knockout Kit (CRISPR)
KN416832 1 Kit

TMEM87A Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details