RecombinantIL-5, Mouse (CHO-expressed)
Interleukin-5 (IL-5), produced by mast cells, T cells and eosinophils, is responsible for the activities attributed to eosinophil differentiating factor, B cell growth factor II and T cell-replacing factor (TRF) . It can increase production and mobilization of eosinophils and CD34+ progenitors from the bone marrow. IL-5 plays an important role in inducing cell-mediated immunity against parasitic infections and certain tumors. IL-5 also promotes differentiation of basophils and primes them for histamine and leukotriene release.Recombinant Murine IL-5 is homodimeric protein with molecular weight ranging from 25 to 40 kDa due to glycosylation.
Product Specifications
CAS Number
9000-83-3
Endotoxin
< 0.2 EU/μg, determined by LAL method.
Purity
> 95% as analyzed by SDS-PAGE and HPLC.
Bioactivity
ED50 < 0.5 ng/ml, measured in a cell proliferation assay using TF-1 cells, corresponding to a specific activity of > 2x10ˆ6 units/mg.
Reconstitution
Reconstituted in ddH2O or PBS at 100 μg/ml.
Molecular Weight
25-40 kDa, observed by non-reducing SDS-PAGE.
Storage Conditions
Appearance
Sterile Filtered White lyophilized (freeze-dried) powder.
Formulation
Lyophilized after extensive dialysis against PBS.
Host or Source
CHO
Recommended Usage
This material is offered by USA Bioworld biotech for research, laboratory or further evaluation purposes. For research use only.
AA Sequence
MEIPMSTVVKETLTQLSAHRALLTSNETMRLPVPTHKNHQLCIGEIFQGLDILKNQTVRGGTVEMLFQNLSLIKKYIDRQ KEKCGEERRRTRQFLDYLQEFLGVMSTEWAMEG
Available Sizes
Explore Other Products
Discover premium biology products from our extensive collection of 20M+ items
ICK (Intestinal Cell Kinase, hICK, ECO, KIAA0936, Laryngeal Cancer Kinase 2, LCK2, MAK-related Kinase, MRK, MGC46090, Serine/Threonine-protein Kinase ICK) (MaxLight 550)
ICK (Intestinal Cell Kinase, hICK, ECO, KIAA0936, Laryngeal Cancer Kinase 2, LCK2, MAK-related Kinase, MRK, MGC46090, Serine/Threonine-protein Kinase ICK) (MaxLight 550)
GIN1, CT (GIN1, TGIN1, ZH2C2, Gypsy retrotransposon integrase-like protein 1, Ty3/Gypsy integrase 1, Zinc finger H2C2 domain-containing protein) (PE)
GIN1, CT (GIN1, TGIN1, ZH2C2, Gypsy retrotransposon integrase-like protein 1, Ty3/Gypsy integrase 1, Zinc finger H2C2 domain-containing protein) (PE)