Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RecombinantIL-5, Human (CHO-expressed)

Interleukin-5 (IL-5), produced by mast cells, T cells and eosinophils, is responsible for the activities attributed to eosinophil differentiating factor, B cell growth factor II and T cell-replacing factor (TRF) . It can increase production and mobilization of eosinophils and CD34+ progenitors from the bone marrow. IL-5 plays an important role in inducing cell-mediated immunity against parasitic infections and certain tumors. IL-5 also promotes differentiation of basophils and primes them for histamine and leukotriene release.Recombinant Human IL-5 is homodimeric protein with molecular weight ranging from 29 to 35 kDa due to glycosylation.

Product Specifications

CAS Number

9000-83-3

Endotoxin

< 0.2 EU/μg, determined by LAL method.

Purity

> 95% as analyzed by SDS-PAGE and HPLC.

Bioactivity

ED50 < 1 ng/ml, measured in a cell proliferation assay using TF-1 cells, corresponding to a specific activity of > 1x10ˆ6 units/mg.

Reconstitution

Reconstituted in ddH2O or PBS at 100 μg/ml.

Molecular Weight

~29-35 kDa, observed by non-reducing SDS-PAGE.

Storage Conditions

Lyophilized recombinant human Interlerkin 5 (rhIL-5) remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, rhIL-5 should be stable up to 1 week at 4°C or up to 2 months at -20°C.

Appearance

Sterile Filtered White lyophilized (freeze-dried) powder.

Formulation

Lyophilized after extensive dialysis against PBS.

Host or Source

CHO

Recommended Usage

This material is offered by USA Bioworld biotech for research, laboratory or further evaluation purposes. For research use only.

AA Sequence

IPTEIPTSALVKETLALLSTHRTLLIANETLRIPVPVHKNHQLCTEEIFQGIGTLESQTVQGGTVERLFKNLSLIKKYID GQKKKCGEERRRVNQFLDYLQEFLGVMNTEWIIES

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

HP Antibody : FITC (OABF00839-FITC)
OABF00839-FITC 100 µL

HP Antibody : FITC (OABF00839-FITC)

Sign In for Pricing
View Details
Anti-DHRS2 Antibody Picoband® FITC Conjugated
A09810-1-FITC 100 µg/Vial

Anti-DHRS2 Antibody Picoband® FITC Conjugated

Sign In for Pricing
View Details
Granzyme M (m) -PR
sc-60762-PR 10 µM - 20 µL

Granzyme M (m) -PR

Sign In for Pricing
View Details
LRSAM1 (NM_001005373) Human Recombinant Protein
PROTQ6UWE0 20 µg

LRSAM1 (NM_001005373) Human Recombinant Protein

Sign In for Pricing
View Details
SETD3 (NM_199123) Human Over-expression Lysate
LC404739 20 µg

SETD3 (NM_199123) Human Over-expression Lysate

Sign In for Pricing
View Details
LIN54 (NM_001288996) Human Tagged ORF Clone
RG239244 10 µg

LIN54 (NM_001288996) Human Tagged ORF Clone

Sign In for Pricing
View Details