RecombinantIL-4, Mouse
Interleukin-4 (IL-4) is a pleiotropic cytokine regulates diverse T and B cell responses including cell proliferation, survival, and gene expression. It has important effects on the growth and differentiation of different immunologically competent cells. Interleukin-4 is produced by mast cells, T cells, and bone marrow stromal cells[1]. IL-4 regulates the differentiation of native CD4+ T cells (Th0 cells) into helper Th2 cells, and regulates the immunoglobulin class switching to the IgG1 and IgE isotypes. IL-4 has numerous important biological functions including stimulating B-cells activation, T-cell proliferation and CD4+ T-cells differentiation to Th2 cells. It is a key regulator in hormone control and adaptive immunity[2]. IL-4 also plays a major role in inflammation response and wound repair via activation of macrophage into M2 cells[3]. IL-4 is stabilized by three disulphide bonds forming a compact globular protein structure[4]. Four alpha-helix bundle with left-handed twist is dominated half of the protein structure with 2 overhand connections and fall into a 2-stranded anti-parallel beta sheet[5].
Product Specifications
Endotoxin
< 0.2 EU/μg, determined by LAL method.
Purity
> 95% as analyzed by SDS-PAGE and HPLC.
Bioactivity
ED50 < 2 ng/ml, measured in a cell proliferation assay using murine HT-2 cells, corresponding to a specific activity of >5 x 10ˆ5 units/mg.
Reconstitution
Reconstituted in ddH2O or PBS at 100 μg/ml.
Molecular Weight
15 kDa, observed by reducing SDS-PAGE.
Storage Conditions
Appearance
Sterile Filtered White lyophilized (freeze-dried) powder.
Formulation
Lyophilized after extensive dialysis against PBS.
Host or Source
CHO
Recommended Usage
This material is offered by USA Bioworld biotech for research, laboratory or further evaluation purposes. For research use only.
CAS Number
9000-83-3
AA Sequence
HIHGCDKNHLREIIGILNEVTGEGTPCTEMDVPNVLTATKNTTESELVCRASKVLRIFYLKHGKTPCLKKNSSVLMELQR LFRAFRCLDSSISCTMNESKSTSLKDFLESLKSIMQMDYS
Available Sizes
Explore Other Products
Discover premium biology products from our extensive collection of 20M+ items