Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RecombinantIL-4, Mouse

Interleukin-4 (IL-4) is a pleiotropic cytokine regulates diverse T and B cell responses including cell proliferation, survival, and gene expression. It has important effects on the growth and differentiation of different immunologically competent cells. Interleukin-4 is produced by mast cells, T cells, and bone marrow stromal cells[1]. IL-4 regulates the differentiation of native CD4+ T cells (Th0 cells) into helper Th2 cells, and regulates the immunoglobulin class switching to the IgG1 and IgE isotypes. IL-4 has numerous important biological functions including stimulating B-cells activation, T-cell proliferation and CD4+ T-cells differentiation to Th2 cells. It is a key regulator in hormone control and adaptive immunity[2]. IL-4 also plays a major role in inflammation response and wound repair via activation of macrophage into M2 cells[3]. IL-4 is stabilized by three disulphide bonds forming a compact globular protein structure[4]. Four alpha-helix bundle with left-handed twist is dominated half of the protein structure with 2 overhand connections and fall into a 2-stranded anti-parallel beta sheet[5].

Product Specifications

Endotoxin

< 0.2 EU/μg, determined by LAL method.

Purity

> 95% as analyzed by SDS-PAGE and HPLC.

Bioactivity

ED50 < 2 ng/ml, measured in a cell proliferation assay using murine HT-2 cells, corresponding to a specific activity of >5 x 10ˆ5 units/mg.

Reconstitution

Reconstituted in ddH2O or PBS at 100 μg/ml.

Molecular Weight

15 kDa, observed by reducing SDS-PAGE.

Storage Conditions

Lyophilized recombinant Murine Interleukin 4 (IL-4) remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, rmIL-4 should be stable up to 1 week at 4°C or up to 2 months at -20°C.

Appearance

Sterile Filtered White lyophilized (freeze-dried) powder.

Formulation

Lyophilized after extensive dialysis against PBS.

Host or Source

CHO

Recommended Usage

This material is offered by USA Bioworld biotech for research, laboratory or further evaluation purposes. For research use only.

CAS Number

9000-83-3

AA Sequence

HIHGCDKNHLREIIGILNEVTGEGTPCTEMDVPNVLTATKNTTESELVCRASKVLRIFYLKHGKTPCLKKNSSVLMELQR LFRAFRCLDSSISCTMNESKSTSLKDFLESLKSIMQMDYS

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Human PDZ domain containing 3 (PDIK1L) ELISA Kit
NSL0946Hu 96 Tests

Human PDZ domain containing 3 (PDIK1L) ELISA Kit

Ask
View Details
DCLRE1C Human Pre-designed siRNA Set A
HY-RS03582 1 Set

DCLRE1C Human Pre-designed siRNA Set A

Ask
View Details
Lentiviral mouse Gatad1 shRNA (UAS) - Lentiviral mouse Gatad1 shRNA (UAS, iRFP) (25)
GTR15278078 1 Vial

Lentiviral mouse Gatad1 shRNA (UAS) - Lentiviral mouse Gatad1 shRNA (UAS, iRFP) (25)

Ask
View Details
AKAP8 antibody
70R-7946 50 ug

AKAP8 antibody

Ask
View Details
Gm3604 AAV Vector (Mouse) (CMV)
21993104 1 μg

Gm3604 AAV Vector (Mouse) (CMV)

Ask
View Details