Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RecombinantIL-4, His, Rat

Interleukin-4 (IL-4), also known as BSF-1 and Lymphocyte stimulatory factor 1, is a secreted cytokine belonging to the IL-4/IL-13 family. It is produced by mast cells, T cells and bone marrow stromal cells. IL-4 signals through two receptor complexes: theIL4Rα/common γ chain and the IL4Rα-IL-13 Rα1 receptor complex. IL-4 regulates T cell and B cell proliferation, survival and gene expression. IL-4 also induces IgG and IgE class switching, and the upregulation of MHC-II production.

Product Specifications

CAS Number

9000-83-3

Endotoxin

< 0.2 EU/μg, determined by LAL method.

Purity

> 95% as analyzed by SDS-PAGE.

Bioactivity

ED50 < 0.2 μg/ml, measured in a proliferationassay using C6 cells.

Reconstitution

Reconstituted in ddH2O or PBS at 100 μg/ml.

Molecular Weight

18-22 kDa, observed by reducing SDS-PAGE.

Storage Conditions

Lyophilized recombinant rat Interleukin-4 (IL-4), Hisremains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, rat Interleukin-4 (IL-4), Hisshould be stable up to 1 week at 4°C or up to 2 months at -20°C.

Appearance

Sterile Filtered White lyophilized (freeze-dried) powder.

Formulation

Lyophilized after extensive dialysis against PBS.

Host or Source

CHO

Recommended Usage

This material is offered by USA Bioworld biotech for research, laboratory or further evaluation purposes. For research use only.

AA Sequence

HGCNDSPLREIINTLNQVTEKGTPCTEMFVPDVLTATRNTTENELICRASRVLRKFYFPRDVPPCLKNKSGVLGELRKLC RGVSGLNSLRSCTVNESTLTTLKDFLESLKSILRGKYLQSCTSMSHHHHHH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Etifoxine 5mg
A15083-5 5 mg

Etifoxine 5mg

Sign In for Pricing
View Details
Mouse Monoclonal ZMYM3 Antibody (PCRP-ZMYM3-2F10) [DyLight 680]
NBP3-08875FR 100 µL

Mouse Monoclonal ZMYM3 Antibody (PCRP-ZMYM3-2F10) [DyLight 680]

Sign In for Pricing
View Details
SAR131675
C08900-50mg 50 mg

SAR131675

Sign In for Pricing
View Details
Human TSPAN3 shRNA Plasmid
abx956807-01 150 µg

Human TSPAN3 shRNA Plasmid

Sign In for Pricing
View Details
Human TSPAN3 shRNA Plasmid
abx956807-02 300 µg

Human TSPAN3 shRNA Plasmid

Sign In for Pricing
View Details
Macrophage Inflammatory Protein 3, Human (MIP-3) (MaxLight 490)
MBS6485962-01 0.1 mL

Macrophage Inflammatory Protein 3, Human (MIP-3) (MaxLight 490)

Sign In for Pricing
View Details