Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RecombinantIL-3, His, Rat

Interleukin-3 (IL-3), also known as MCGF, Multi-CSF, HCGF and P-cell stimulation factor, belongs tothe α-helixfamily of hematopoietic cytokines. It is produced by activated T-cells, mast cells and natural killer cells. IL-3 binds to the IL-3 receptor alpha subunit and recruits the signal-transducing common beta chain. IL-3induced signal transduction results in the survival, differentiation and proliferation of a variety of immune cells, such as macrophages, neutrophils, megakaryocytes, mast cells and hematopoietic stem cells. IL-3 often acts synergistically with other cytokines, such as IL-7, EPO, GM-CSF and IL-6, to exert its simulative function.

Product Specifications

CAS Number

9000-83-3

Endotoxin

< 0.2 EU/μg, determined by LAL method.

Purity

> 95% as analyzed by SDS-PAGE.

Bioactivity

ED50 < 8 ng/ml, measured in a cell proliferation assay using NF S-60 cells.

Reconstitution

Reconstituted in ddH2O or PBS at 100 μg/ml.

Molecular Weight

22-34 kDa, observed by reducing SDS-PAGE.

Storage Conditions

Lyophilized recombinant ratInterleukin-3 (IL-3), His remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, rat Interleukin-3 (IL-3), His should be stable up to 1 week at 4°C or up to 2 months at -20°C.

Appearance

Sterile Filtered White lyophilized (freeze-dried) powder.

Formulation

Lyophilized after extensive dialysis against PBS.

Host or Source

CHO

Recommended Usage

This material is offered by USA Bioworld biotech for research, laboratory or further evaluation purposes. For research use only.

AA Sequence

ISDRGSDAHHLLRTLDCRTIALEILVKLPYPQVSGLNNSDDKANLRNSTLRRVNLDEFLKSQEEFDSQDTTDIKSKLQKL KCCIPAAASDSVLPGVYNKDLDDFKKKLRFYVIHLKDLQPVSVSRPPQPTSSSDNFRPMTVECHHHHHH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

APOA1
520145-01 100 µL

APOA1

Sign In for Pricing
View Details
APOA1
520145-02 200 µL

APOA1

Sign In for Pricing
View Details
Human Parathyroid Hormone 2 Receptor (PTH2R) ELISA Kit
MBS9714729-01 48 Tests

Human Parathyroid Hormone 2 Receptor (PTH2R) ELISA Kit

Sign In for Pricing
View Details
Human Parathyroid Hormone 2 Receptor (PTH2R) ELISA Kit
MBS9714729-02 96 Tests

Human Parathyroid Hormone 2 Receptor (PTH2R) ELISA Kit

Sign In for Pricing
View Details
Human Parathyroid Hormone 2 Receptor (PTH2R) ELISA Kit
MBS9714729-03 5x 96 Tests

Human Parathyroid Hormone 2 Receptor (PTH2R) ELISA Kit

Sign In for Pricing
View Details
LCA5 (Lebercilin, Leber Congenital Amaurosis 5)
484651 100 µL

LCA5 (Lebercilin, Leber Congenital Amaurosis 5)

Sign In for Pricing
View Details