Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RecombinantIL-1β, Mouse (CHO-expressed)

Interleukin-1 (IL-1) is a family of cytokines that play a central role in the regulation of immune and inflammatory responses to infections or sterile insults. IL-1α and IL-1β are the first two members discovered in this family, which are the products of distinct genes recognizing the same cell surface receptors. IL-1α and IL-1β are structurally related polypeptides that show approximately 25% homology at the amino acid level. Both proteins are produced by a wide variety of cells in response to stimuli such as those produced by inflammatory agents, infections, or microbial endotoxins. The proteins are synthesized as 31 kDa precursors that are subsequently cleaved into proteins with molecular weights of approximately 17.5 kDa. The specific protease responsible for the processing of IL-1β is interleukin 1β-converting enzyme (ICE) /caspase-1. Mature human and mouse IL-1β share approximately 75% amino acid sequence identity where human IL-1β has been found to be active on murine cell lines. GenScript Interleukin (IL) -1β, murine, produced in CHO cells, is a non-glycosylated polypeptide chain containing 152 amino acids and having a molecular mass of 17,400 Da.

Product Specifications

CAS Number

9000-83-3

Endotoxin

<0.2 EU/μg, determined by LAL method.

Purity

> 95% as analyzed by SDS-PAGE and HPLC.

Bioactivity

ED50 < 10 pg/ml, measured in a cell proliferation assay using D10S cells, corresponding to a specific activity of > 1x10ˆ8 units/mg.

Reconstitution

Reconstituted in ddH2O or PBS at 100 μg/ml.

Molecular Weight

17.4 kDa, observed by non-reducing SDS-PAGE.

Storage Conditions

Lyophilized recombinant Murine Interleukin 1 beta (IL-1 beta) remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, rmIL-1beta should be stable up to 1 week at 4°C or up to 2 months at -20°C.

Appearance

Sterile Filtered White lyophilized (freeze-dried) powder.

Formulation

Lyophilized after extensive dialysis against PBS.

Host or Source

CHO

Recommended Usage

This material is offered by USA Bioworld biotech for research, laboratory or further evaluation purposes. For research use only.

AA Sequence

VPIRQLHYRLRDEQQKSLVLSDPYELKALHLNGQNINQQVIFSMSFVQGEPSNDKIPVALGLKGKNLYLSCVMKDGTPTL QLESVDPKQYPKKKMEKRFVFNKIEVKSKVEFESAEFPNWYISTSQAEHKPVFLGNNSGQDIIDFTMESVSS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

2-Propylglutaric acid
FP27233-01 1 mg

2-Propylglutaric acid

Sign In for Pricing
View Details
2-Propylglutaric acid
FP27233-02 2 mg

2-Propylglutaric acid

Sign In for Pricing
View Details
2-Propylglutaric acid
FP27233-03 5 mg

2-Propylglutaric acid

Sign In for Pricing
View Details
2-Propylglutaric acid
FP27233-04 10 mg

2-Propylglutaric acid

Sign In for Pricing
View Details
2-Propylglutaric acid
FP27233-05 25 mg

2-Propylglutaric acid

Sign In for Pricing
View Details
[DPro5] Corticotropin Releasing Factor, human, rat
orb1981083-01 5 mg

[DPro5] Corticotropin Releasing Factor, human, rat

Sign In for Pricing
View Details