Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RecombinantIL-1β, Human (CHO-expressed)

Interleukin 1 beta is a proinflammatory cytokine produced in a variety of cells including monocytes, tissue macrophages, keratinocytes and other epithelial cells. Both IL-1 alpha and IL-1 beta binds to the same receptor and has similar if not identical biological properties. These cytokines have a broad range of activities including, stimulation of thymocyte proliferation, by inducing IL-2 release, B-cell maturation and proliferation, mitogenic FGF-like activity and the ability to stimulate the release of prostaglandin and collagenase from synovial cells. However, whereas IL-1 beta is a secreted cytokine, IL-1 alpha is predominantly a cell-associated cytokine.

Product Specifications

CAS Number

9000-83-3

Endotoxin

<0.2 EU/μg, determined by LAL method.

Purity

> 95% as analyzed by SDS-PAGE and HPLC.

Bioactivity

ED50< 10 pg/ml, measured in a cell proliferation assay using D10S cells, corresponding to a specific activity of >1 x 10ˆ8 units/mg.

Reconstitution

Reconstituted in ddH2O or PBS at 100 μg/ml.

Molecular Weight

17kDa, observed by non-reducing SDS-PAGE.

Storage Conditions

Lyophilized recombinant human Interleukin 1 beta (IL-1 beta) remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, rhIL-1β should be stable up to 1 week at 4°C or up to 2 months at -20°C.

Appearance

Sterile Filtered White lyophilized (freeze-dried) powder.

Formulation

Lyophilized after extensive dialysis against PBS.

Host or Source

CHO

Recommended Usage

This material is offered by USA Bioworld biotech for research, laboratory or further evaluation purposes. For research use only.

AA Sequence

APVRSLNCTLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSMSFVQGEESNDKIPVALGLKEKNLYLSCVLKDDKPTL QLESVDPKNYPKKKMEKRFVFNKIEINNKLEFESAQFPNWYISTSQAENMPVFLGGTKGGQDITDFTMQFVSS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SF3B2
551763 100 µg

SF3B2

Sign In for Pricing
View Details
Hepatitis C Virus NS4a, aa1700-1710 (HCV) (FITC)
H1920-26D-FITC 100 µL

Hepatitis C Virus NS4a, aa1700-1710 (HCV) (FITC)

Sign In for Pricing
View Details
5' IRD700 / 3' BBQ-650
orb1734567 50 to 70 nmol

5' IRD700 / 3' BBQ-650

Sign In for Pricing
View Details
Rabbit anti-GATA1 Antibody
MBS4512958-01 0.05 mL

Rabbit anti-GATA1 Antibody

Sign In for Pricing
View Details
Rabbit anti-GATA1 Antibody
MBS4512958-02 0.1 mL

Rabbit anti-GATA1 Antibody

Sign In for Pricing
View Details
Rabbit anti-GATA1 Antibody
MBS4512958-03 5x 0.1 mL

Rabbit anti-GATA1 Antibody

Sign In for Pricing
View Details