Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RecombinantIL-18BP, Human

Interleukin-18 binding protein, also known as IL-18BP and tadekinig-alfa, is a secreted glycoprotein that contains an Ig-like C2-type domain. It is expressed in heart, lung, placenta and spleen. IL-18BP functions as an inhibitor of the proinflammatory cytokine IL-18. It binds to IL-18, prevents the binding of IL-18 to its receptor, and thus blocks IL-18-induced IFN-gamma production. The complete Ig domain has been shown to mediate the binding and neutralizing properties. IFN-gamma is able to upregulate the expression of IL-18BP, indicating that IL-18 activity is regulated by a feedback mechanism through IL-18BP.

Product Specifications

CAS Number

9000-83-3

Endotoxin

< 0.2 EU/μg, determined by LAL method.

Purity

> 95% as analyzed by SDS-PAGE and HPLC.

Bioactivity

ED50 < 30 ng /ml, measured in a bioassay using KG-1 cells in the presence of 50ng/ml Human IL-18.

Reconstitution

Reconstituted in ddH2O or PBS at 100 μg/ml.

Molecular Weight

42-44 kDa, observed by reducing SDS-PAGE.

Storage Conditions

Lyophilized recombinant Human IL-18BP remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, Human IL-18BP should be stable up to 1 week at 4°C or up to 2 months at -20°C.

Appearance

Sterile Filtered White lyophilized (freeze-dried) powder.

Formulation

Lyophilized after extensive dialysis against PBS.

Host or Source

CHO

Recommended Usage

This material is offered by USA Bioworld biotech for research, laboratory or further evaluation purposes. For research use only.

AA Sequence

TPVSQTTTAATASVRSTKDPCPSQPPVFPAAKQCPALEVTWPEVEVPLNGTLSLSCVACSRFPNFSILYWLGNGSFIEHL PGRLWEGSTSRERGSTGTQLCKALVLEQLTPALHSTNFSCVLVDPEQVVQRHVVLAQLWAGLRATLPPTQEALPSSHSSP QQQG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rheostats, Sliding Contact, Open Type, Single Tube
1091080/9F 1 Each

Rheostats, Sliding Contact, Open Type, Single Tube

Sign In for Pricing
View Details
Porcine Peroxisome Proliferator Activated Receptor Delta ELISA Kit
MBS087884-01 48 Well

Porcine Peroxisome Proliferator Activated Receptor Delta ELISA Kit

Sign In for Pricing
View Details
Porcine Peroxisome Proliferator Activated Receptor Delta ELISA Kit
MBS087884-02 96 Well

Porcine Peroxisome Proliferator Activated Receptor Delta ELISA Kit

Sign In for Pricing
View Details
Porcine Peroxisome Proliferator Activated Receptor Delta ELISA Kit
MBS087884-03 5x 96 Well

Porcine Peroxisome Proliferator Activated Receptor Delta ELISA Kit

Sign In for Pricing
View Details
Porcine Peroxisome Proliferator Activated Receptor Delta ELISA Kit
MBS087884-04 10x 96 Well

Porcine Peroxisome Proliferator Activated Receptor Delta ELISA Kit

Sign In for Pricing
View Details
Recombinant Emericella nidulans Mediator of RNA polymerase II transcription subunit 21 (srb7)
MBS1483760-01 0.05 mg (E-Coli)

Recombinant Emericella nidulans Mediator of RNA polymerase II transcription subunit 21 (srb7)

Sign In for Pricing
View Details