Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RecombinantIL-17A, His, Human

Interleukin-17A (IL-17A), also known as CTLA-8 and IL-17, is a proinflammatory cytokine belonging to the IL-17 family. It is secreted by Th17 cells, gamma/delta T cells, NK cells and neutrophils. IL-17A signals through IL-17 receptor A in a complex with receptor C or D to regulate NF-kappaB and MAP kinase activities. IL-17A plays important roles in the anti-microbial response and chronic inflammation. It stimulates the production of IL-6, IL-8 and G-CSF in epithelial and endothelial cells, and induces the expression of ICAM-1 in fibroblasts. Clinically, IL-17A has been associated with inflammatory diseases, such as rheumatoid arthritis, psoriasis and multiple sclerosis.Recombinant human Interleukin-17A (rhIL-17A) produced in CHO cells is a glycosylated homodimer chain containing 142 amino acids. A fully biologically active molecule, rhIL-17A has a molecular mass of around 14-22 kDa analyzed by reducing SDS-PAGE and is obtained by chromatographic techniques at GenScript.

Product Specifications

CAS Number

9000-83-3

Endotoxin

< 0.2 EU/μg, determined by LAL method.

Purity

> 95% as analyzed by SDS-PAGE.

Bioactivity

ED50 < 0.3 ng/ml, measured in a bioassay using NHDF cells, corresponding to a specific activity of > 3.3x10ˆ6 units/mg.

Reconstitution

Reconstituted in ddH2O or PBS at 100 μg/ml.

Molecular Weight

14-22 kDa, observed by reducing SDS-PAGE.

Storage Conditions

Lyophilized recombinant humanInterleukin-17A (IL-17A), His remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, human Interleukin-17A (IL-17A), His should be stable up to 1 week at 4°C or up to 2 months at -20°C.

Appearance

Sterile Filtered White lyophilized (freeze-dried) powder.

Formulation

Lyophilized after extensive dialysis against PBS.

Host or Source

CHO

Recommended Usage

This material is offered by USA Bioworld biotech for research, laboratory or further evaluation purposes. For research use only.

AA Sequence

GITIPRNPGCPNSEDKNFPRTVMVNLNIHNRNTNTNPKRSSDYYNRSTSPWNLHRNEDPERYPSVIWEAKCRHLGCINAD GNVDYHMNSVPIQQEILVLRREPPHCPNSFRLEKILVSVGCTCVTPIVHHVAHHHHHH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cilium assembly protein DZIP1 Antibody (FITC)
orb3156795 100 µg

Cilium assembly protein DZIP1 Antibody (FITC)

Sign In for Pricing
View Details
Human SLC35E2A Pre-designed siRNA Set A
SI015065A 1 Each

Human SLC35E2A Pre-designed siRNA Set A

Sign In for Pricing
View Details
C-Type Lectin Domain Family 2, Member C (CLEC2C), Recombinant, Human, His-Tag
054480-01 10 µg

C-Type Lectin Domain Family 2, Member C (CLEC2C), Recombinant, Human, His-Tag

Sign In for Pricing
View Details
C-Type Lectin Domain Family 2, Member C (CLEC2C), Recombinant, Human, His-Tag
054480-02 50 µg

C-Type Lectin Domain Family 2, Member C (CLEC2C), Recombinant, Human, His-Tag

Sign In for Pricing
View Details
C-Type Lectin Domain Family 2, Member C (CLEC2C), Recombinant, Human, His-Tag
054480-03 100 µg

C-Type Lectin Domain Family 2, Member C (CLEC2C), Recombinant, Human, His-Tag

Sign In for Pricing
View Details
C-Type Lectin Domain Family 2, Member C (CLEC2C), Recombinant, Human, His-Tag
054480-04 200 µg

C-Type Lectin Domain Family 2, Member C (CLEC2C), Recombinant, Human, His-Tag

Sign In for Pricing
View Details