Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RecombinantIL-13, His, Mouse (CHO-expressed)

Interleukin-13 (IL-13), also known as T-cell activation protein P600, is an immunoregulatory cytokine belonging to the IL-4/IL-13 family. It is produced by activated Th2 cells, mast cells and NK cells. IL-13 signals through a receptor complex composed of IL-4Rα and IL13Rα1 (or IL13Rα2) . IL-13 inhibits the expression of inflammatory cytokines such as IL-1β, TNF-α and IL-6 by monocytes and macrophages. It also induces B cell activation and IgE secretion.

Product Specifications

CAS Number

9000-83-3

Endotoxin

< 0.2 EU/μg, determined by LAL method.

Purity

> 95% as analyzed by SDS-PAGE.

Bioactivity

ED50 < 20 ng /ml, measured in a cell proliferation assay using R&D TF-1 cells.

Reconstitution

Reconstituted in ddH2O or PBS at 100 μg/ml.

Molecular Weight

14-30 kDa, observed by reducing SDS-PAGE.

Storage Conditions

Lyophilized recombinant murine Interleukin-13 (IL-13), His remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, murine Interleukin-13 (IL-13), His should be stable up to 1 week at 4°C or up to 2 months at -20°C.

Appearance

Sterile Filtered White lyophilized (freeze-dried) powder.

Formulation

Lyophilized after extensive dialysis against PBS.

Host or Source

CHO

Recommended Usage

This material is offered by USA Bioworld biotech for research, laboratory or further evaluation purposes. For research use only.

AA Sequence

PVPRSVSLPLTLKELIEELSNITQDQTPLCNGSMVWSVDLAAGGFCVALDSLTNISNCNAIYRTQRILHGLCNRKAPTTV SSLPDTKIEVAHFITKLLSYTKQLFRHGPFHHHHHH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TMOD2 Peptide - N-terminal region
MBS3236989-01 0.1 mg

TMOD2 Peptide - N-terminal region

Sign In for Pricing
View Details
TMOD2 Peptide - N-terminal region
MBS3236989-02 5x 0.1 mg

TMOD2 Peptide - N-terminal region

Sign In for Pricing
View Details
GBP2 (Interferon-Induced Guanylate-Binding Protein 2, GTP-Binding Protein 2, GBP-2, HuGBP-2, Guanine Nucleotide-Binding Protein 2, GBP2) (AP) discontinued
302464-AP 200 µL

GBP2 (Interferon-Induced Guanylate-Binding Protein 2, GTP-Binding Protein 2, GBP-2, HuGBP-2, Guanine Nucleotide-Binding Protein 2, GBP2) (AP) discontinued

Sign In for Pricing
View Details
Recombinant Human ABCG4 Protein, N-His
E55P3385 50 µg

Recombinant Human ABCG4 Protein, N-His

Sign In for Pricing
View Details
Recombinant Human KRT8/CK-8 Protein, N-His
AP96131 50 µg

Recombinant Human KRT8/CK-8 Protein, N-His

Sign In for Pricing
View Details
Phospho-Estrogen Receptor alpha (Ser106) Rabbit Polyclonal Antibody (BF405)
orb1589982 100 µL

Phospho-Estrogen Receptor alpha (Ser106) Rabbit Polyclonal Antibody (BF405)

Sign In for Pricing
View Details