Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RecombinantIL-12, His, Rat

Interleukin-12 (IL-12), also known as NKSF, TCMF, CLMF and TSF, is a heterodimeric cytokine composed of p35 and p40 subunits. It is produced by monocytes, macrophages, B cells and dendritic cells in response to bacterial lipopolysaccharides and intracellular pathogens. IL-12 signals through the IL-12 receptor complex, which is comprised of IL-12 Rβ1 and IL-12 Rβ2. IL-12 induces the proliferation and activation of hematopoietic stem cells, natural killer cells and T- cells. It is indispensible during the development of Th1 cells, leading to the production of IFN-gamma and IL-2.

Product Specifications

CAS Number

9000-83-3

Endotoxin

<0.2 EU/μg, determined by LAL method.

Purity

> 95% as analyzed by SDS-PAGE.

Bioactivity

ED50< 0.1ng/ml, measured in a cell proliferation assay using 2D6 cells.

Reconstitution

Reconstituted in ddH2O or PBS at 100 μg/ml.

Molecular Weight

26-28kDa (p35) and 42-45 kDa (p40), observed by reducing SDS-PAGE.

Storage Conditions

Lyophilized recombinant rat Interleukin-12 (IL-12), His remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, rat Interleukin-12 (IL-12), His should be stable up to 1 week at 4°C or up to 2 months at -20°C.

Appearance

Sterile Filtered White lyophilized (freeze-dried) powder.

Formulation

Lyophilized after extensive dialysis against PBS.

Host or Source

CHO

Recommended Usage

This material is offered by USA Bioworld biotech for research, laboratory or further evaluation purposes. For research use only.

AA Sequence

P35: RVIPVSGPAKCLNQSQNLLKTTDDMVRTAREKLKHYSCTAGDIDHEDITRDKTSTLEACL PLELHKNESCLATKETSSIIRGSCLPPQKTSLMMTLCLGSIYEDLKMYQSEFQAINAALQ SHNHQQITLDRNMLMAIDELMRSLNHSGETLHQKAPMGEADPYRVKMKLCILLHAFSTRV MTINRVMNYLSSSHHHHHH p40: MWELEKDVYVVEVDWRPDAPGETVTLTCDSPEEDDITWTSDQRRGVIGSGKTLTITVREFLDAGQYTCHRGGETLSHSHL LLHKKENGIWSTEILKNFKNKTFLKCEAPNYSGRFTCSWLVHRNTDLKFNIKSSSSSPESRAVTCGRASLSAEKVTLNQR DYEKYSVACQEDVTCPTAEETLPIELVVEAQQQNKYENYSTSFFIRDIIKPDPPKNLQVKPLKNSQVEVSWEYPDSWSTP HSYFSLKFFVRIQRKKEKTKETEEECNQKGAFLVEKTSAEVQCKGANICVQAQDRYYNSSCSKWTCVPCRGRS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Scavenger Receptor Class A Member 5 (SCARA5) Antibody
abx237623 100 µg

Scavenger Receptor Class A Member 5 (SCARA5) Antibody

Sign In for Pricing
View Details
GM4724 AAV Vector (Mouse) (CMV)
58236104 1 µg

GM4724 AAV Vector (Mouse) (CMV)

Sign In for Pricing
View Details
Zfp493 sgRNA CRISPR Lentivector set (Mouse)
K4710901 3x 1.0 µg

Zfp493 sgRNA CRISPR Lentivector set (Mouse)

Sign In for Pricing
View Details
TLC Plates, Alumina, Neutral, Glass Backing, without Fluorescent Indicator, 10x20cm, pack of 40
SI56084 1 Each

TLC Plates, Alumina, Neutral, Glass Backing, without Fluorescent Indicator, 10x20cm, pack of 40

Sign In for Pricing
View Details
ECOS 9-5 (JM109
FYE709-10VL 100 μL x 10 Vials

ECOS 9-5 (JM109

Sign In for Pricing
View Details
Recombinant Staphylococcus aureus Putative membrane protein insertion efficiency factor (SAUSA300_1736)
MBS1325726-01 0.02 mg (E-Coli)

Recombinant Staphylococcus aureus Putative membrane protein insertion efficiency factor (SAUSA300_1736)

Sign In for Pricing
View Details