Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RecombinantIL-12, His, Rat

Interleukin-12 (IL-12), also known as NKSF, TCMF, CLMF and TSF, is a heterodimeric cytokine composed of p35 and p40 subunits. It is produced by monocytes, macrophages, B cells and dendritic cells in response to bacterial lipopolysaccharides and intracellular pathogens. IL-12 signals through the IL-12 receptor complex, which is comprised of IL-12 Rβ1 and IL-12 Rβ2. IL-12 induces the proliferation and activation of hematopoietic stem cells, natural killer cells and T- cells. It is indispensible during the development of Th1 cells, leading to the production of IFN-gamma and IL-2.

Product Specifications

CAS Number

9000-83-3

Endotoxin

<0.2 EU/μg, determined by LAL method.

Purity

> 95% as analyzed by SDS-PAGE.

Bioactivity

ED50< 0.1ng/ml, measured in a cell proliferation assay using 2D6 cells.

Reconstitution

Reconstituted in ddH2O or PBS at 100 μg/ml.

Molecular Weight

26-28kDa (p35) and 42-45 kDa (p40), observed by reducing SDS-PAGE.

Storage Conditions

Lyophilized recombinant rat Interleukin-12 (IL-12), His remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, rat Interleukin-12 (IL-12), His should be stable up to 1 week at 4°C or up to 2 months at -20°C.

Appearance

Sterile Filtered White lyophilized (freeze-dried) powder.

Formulation

Lyophilized after extensive dialysis against PBS.

Host or Source

CHO

Recommended Usage

This material is offered by USA Bioworld biotech for research, laboratory or further evaluation purposes. For research use only.

AA Sequence

P35: RVIPVSGPAKCLNQSQNLLKTTDDMVRTAREKLKHYSCTAGDIDHEDITRDKTSTLEACL PLELHKNESCLATKETSSIIRGSCLPPQKTSLMMTLCLGSIYEDLKMYQSEFQAINAALQ SHNHQQITLDRNMLMAIDELMRSLNHSGETLHQKAPMGEADPYRVKMKLCILLHAFSTRV MTINRVMNYLSSSHHHHHH p40: MWELEKDVYVVEVDWRPDAPGETVTLTCDSPEEDDITWTSDQRRGVIGSGKTLTITVREFLDAGQYTCHRGGETLSHSHL LLHKKENGIWSTEILKNFKNKTFLKCEAPNYSGRFTCSWLVHRNTDLKFNIKSSSSSPESRAVTCGRASLSAEKVTLNQR DYEKYSVACQEDVTCPTAEETLPIELVVEAQQQNKYENYSTSFFIRDIIKPDPPKNLQVKPLKNSQVEVSWEYPDSWSTP HSYFSLKFFVRIQRKKEKTKETEEECNQKGAFLVEKTSAEVQCKGANICVQAQDRYYNSSCSKWTCVPCRGRS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Fish Prenylcysteine Oxidase 1 ELISA Kit
MBS067141 Inquire

Fish Prenylcysteine Oxidase 1 ELISA Kit

Sign In for Pricing
View Details
Human CTF1 (Cardiotrophin-1) QuickTest ELISA Kit
QT-EH1055 96 Tests

Human CTF1 (Cardiotrophin-1) QuickTest ELISA Kit

Sign In for Pricing
View Details
Rabbit Anti Human CYP17A1 Polyclonal Affinity Purified (PBS with 0.05% sodium azide and 50% glycerol, pH7.4) (IHC,ELISA) 200ul
IRBAHUCYP17A1AP124200UL 200 µL

Rabbit Anti Human CYP17A1 Polyclonal Affinity Purified (PBS with 0.05% sodium azide and 50% glycerol, pH7.4) (IHC,ELISA) 200ul

Sign In for Pricing
View Details
RanBP7 Polyclonal Antibody, AbBy Fluor™ 680 Conjugated
bs-8590R-BF680 100 µL

RanBP7 Polyclonal Antibody, AbBy Fluor™ 680 Conjugated

Sign In for Pricing
View Details
PLEKHQ1 Lentiviral Activation Particles (h2)
sc-417371-LAC-2 200 µL

PLEKHQ1 Lentiviral Activation Particles (h2)

Sign In for Pricing
View Details
KRTAP10-2 CRISPRa sgRNA lentivector (set of three targets)(Human)
26113121 3x 1.0µg DNA

KRTAP10-2 CRISPRa sgRNA lentivector (set of three targets)(Human)

Sign In for Pricing
View Details