Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RecombinantIL-11, Human (CHO-expressed)

Interleukin-11 is a pleiotropic cytokine that was originally detected in the conditioned medium of an IL-1α-stimulated primate bone marrow stromal cell line (PU-34) as a mitogen for the IL-6-responsive mouse plasmacytoma cell line T11. IL-11 has multiple effects on both hematopoietic and non-hematopoietic cells. Many of the biological effects described for IL-11 overlap with those for IL-6. In vitro, IL-11 can synergize with IL-3, IL-4 and SCF to shorten the G0 period of early hematopoietic progenitors. IL-11 also enhances the IL-3-dependent megakaryocyte colony formation. IL-11 has been found to stimulate the T cell-dependent development of specific immunoglobulin-secreting B cells.

Product Specifications

CAS Number

9000-83-3

Endotoxin

< 0.2 EU/μg, determined by LAL method.

Purity

> 95% as analyzed by SDS-PAGE and HPLC.

Bioactivity

ED50 <5 ng/ml, measured in a proliferation assay using T11 cells.

Reconstitution

Reconstituted in ddH2O or PBS at 100 μg/ml.

Molecular Weight

~23 kDa, observed by reducing SDS-PAGE.

Storage Conditions

Lyophilized recombinant Human Interleukin-11 remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, Human Interleukin-11 should be stable up to 1 week at 4°C or up to 2 months at -20°C.

Appearance

Sterile Filtered White lyophilized (freeze-dried) powder.

Formulation

Lyophilized after extensive dialysis against PBS.

Host or Source

CHO

Recommended Usage

This material is offered by USA Bioworld biotech for research, laboratory or further evaluation purposes. For research use only.

AA Sequence

PGPPPGPPRVSPDPRAELDSTVLLTRSLLADTRQLAAQLRDKFPADGDHNLDSLPTLAMSAGALGALQLPGVLTRLRADL LSYLRHVQWLRRAGGSSLKTLEPELGTLQARLDRLLRRLQLLMSRLALPQPPPDPPAPPLAPPSSAWGGIRAAHAILGGL HLTLDWAVRGLLLLKTRL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

6-Bromo-3-nitropyrazolo[1,5-a]pyrimidine
438076-01 25 mg

6-Bromo-3-nitropyrazolo[1,5-a]pyrimidine

Sign In for Pricing
View Details
6-Bromo-3-nitropyrazolo[1,5-a]pyrimidine
438076-02 50 mg

6-Bromo-3-nitropyrazolo[1,5-a]pyrimidine

Sign In for Pricing
View Details
PTPRN (Protein Tyrosine Phosphatase, Receptor Type, N, FLJ16131, IA-2, IA-2/PTP, IA2, ICA512, R-PTP-N) (MaxLight 405)
MBS6197481-01 0.1 mL

PTPRN (Protein Tyrosine Phosphatase, Receptor Type, N, FLJ16131, IA-2, IA-2/PTP, IA2, ICA512, R-PTP-N) (MaxLight 405)

Sign In for Pricing
View Details
PTPRN (Protein Tyrosine Phosphatase, Receptor Type, N, FLJ16131, IA-2, IA-2/PTP, IA2, ICA512, R-PTP-N) (MaxLight 405)
MBS6197481-02 5x 0.1 mL

PTPRN (Protein Tyrosine Phosphatase, Receptor Type, N, FLJ16131, IA-2, IA-2/PTP, IA2, ICA512, R-PTP-N) (MaxLight 405)

Sign In for Pricing
View Details
LIM kinase 2 (LIMK2) Human Over-expression Lysate
orb1369360 20 µg

LIM kinase 2 (LIMK2) Human Over-expression Lysate

Sign In for Pricing
View Details
Lentiviral mouse Ogt shRNA (UAS) - Lentiviral mouseOgt shRNA (UAS, GFP) (25)
GTR15229460 1 Vial

Lentiviral mouse Ogt shRNA (UAS) - Lentiviral mouseOgt shRNA (UAS, GFP) (25)

Sign In for Pricing
View Details