Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RecombinantHCC‑4/CCL16, Human (CHO-expressed)

Human HCC­4, also named NCC­4and Chemokine (C-C motif) ligand 16 (CCL16) is a small cytokine belonging to the CC chemokine family that is known under several pseudonyms, including Liver-expressed chemokine (LEC) and Monotactin-1 (MTN-1) . It can signal through the CCR8 and CCR1 receptors, and it is chemotactic towards monocytes and lymphocytes but not neutrophils. HCC-4 is expressed weakly by some lymphocytes, including NK cells, T cells, and some T cell clones. The expression of HCC-4 in monocytes is greatly up-regulated in the presence of IL-10. HCC-4 induces a calcium flux in thp-1 cells that are desensitized prior to the expression of RANTES. Recombinant human HCC‑4/CCL16 produced in CHO cells is a single non-glycosylated polypeptide chain containing 97 amino acids. A fully biologically active molecule, rhHCC‑4/CCL16has a molecular mass of 12 kDa analyzed by reducing SDS-PAGE and is obtained by chromatographic techniques at GenScript.

Product Specifications

CAS Number

9000-83-3

Endotoxin

< 0.2 EU/μg, determined by LAL method.

Purity

> 98% as analyzed by SDS-PAGE.

Bioactivity

The EC50 value of human HCC‑4/CCL16 on Caˆ2+ mobilization assay in CHO-K1/Ga15/hCCR1 cells (human Ga15 and human CCR1 stably expressed in CHO-K1 cells) is less than 1.5 μg/ml.

Reconstitution

Reconstituted in ddH2O or PBS at 100 μg/ml.

Molecular Weight

12 kDa, observed by reducing SDS-PAGE.

Storage Conditions

Lyophilized recombinant human HCC‑4/CCL16 remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, human HCC‑4/CCL16 should be stable up to 1 week at 4°C or up to 2 months at -20°C.

Appearance

Sterile Filtered White lyophilized (freeze-dried) powder.

Formulation

Lyophilized after extensive dialysis against PBS.

Host or Source

CHO

Recommended Usage

This material is offered by USA Bioworld biotech for research, laboratory or further evaluation purposes. For research use only.

AA Sequence

QPKVPEWVNTPSTCCLKYYEKVLPRRLVVGYRKALNCHLPAIIFVTKRNREVCTNPNDDWVQEYIKDPNLPLLPTRNLST VKIITAKNGQPQLLNSQ

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

SOX13 Peptide (AAP33728)
AAP33728-100UG 100 µg

SOX13 Peptide (AAP33728)

Sign In for Pricing
View Details
Rat Glucocorticoid receptor ELISA Kit
EK3811 Inquire

Rat Glucocorticoid receptor ELISA Kit

Sign In for Pricing
View Details
HMGA1 (High mobility group Protein HMG-I/HMG-Y)
482818 100 µL

HMGA1 (High mobility group Protein HMG-I/HMG-Y)

Sign In for Pricing
View Details
AKR7A2 Rabbit Polyclonal Antibody (Fluoro550)
orb3101015 100 µg

AKR7A2 Rabbit Polyclonal Antibody (Fluoro550)

Sign In for Pricing
View Details
Sulfo-NHS-SS-Biotin 10mg
A14903-10 10 mg

Sulfo-NHS-SS-Biotin 10mg

Sign In for Pricing
View Details
Mouse ADM ELISA Kit
orb1665239 96 Tests

Mouse ADM ELISA Kit

Sign In for Pricing
View Details