Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RecombinantHB-EGF, Human

Proheparin-binding EGF-like growth factor (HB-EGF), also known as DTR, DTS and HEGFL, is a member of the EGF family of mitogens. It is expressed in macrophages, monocytes, endothelial cells and muscle cells. HB-EGF signals through the EGF receptor to stimulate the proliferation of smooth muscle cells, epithelial cells and keratinocytes. Compared to EGF, HB-EGF binds the EGF receptor with higher affinity and is thus more mitogenic, probably due to its ability to bind to heparin and heparin sulfate proteoglycans. HB-EGF has been reported to act as a diphtheria toxin receptor, mediating endocytosis of the bound toxin.

Product Specifications

CAS Number

9000-83-3

Endotoxin

< 0.2 EU/μg, determined by LAL method.

Purity

> 95% as analyzed by SDS-PAGE and HPLC.

Bioactivity

ED50 <0.5 ng/ml, measured in a cell proliferation assay using 3T3 cells.

Reconstitution

Reconstituted in ddH2O or PBS at 100 μg/ml.

Molecular Weight

12-14 kDa, observed by reducing SDS-PAGE.

Storage Conditions

Lyophilized recombinant Human HB-EGF remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, Human HB-EGF should be stable up to 1 week at 4°C or up to 2 months at -20°C.

Appearance

Sterile Filtered White lyophilized (freeze-dried) powder.

Formulation

Lyophilized after extensive dialysis against PBS.

Host or Source

CHO

Recommended Usage

This material is offered by USA Bioworld biotech for research, laboratory or further evaluation purposes. For research use only.

AA Sequence

DLQEADLDLLRVTLSSKPQALATPNKEEHGKRKKKGKGLGKKRDPCLRKYKDFCIHGECKYVKELRAPSCICHPGYHGER CHGLSL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RABEP2 Protein Vector (Rat) (pPB-C-His)
PV297886 500 ng

RABEP2 Protein Vector (Rat) (pPB-C-His)

Sign In for Pricing
View Details
Site-Saturation Mutagenesis Library Service [RFQ]
GTR14653348 1 Each

Site-Saturation Mutagenesis Library Service [RFQ]

Sign In for Pricing
View Details
Mouse Primary Coronary Endothelial Cells
AFG-ELL-0670 > 5x 10^5 Cells / Vial

Mouse Primary Coronary Endothelial Cells

Sign In for Pricing
View Details
HBcAg (Hepatitis B Core) (Biotin)
MBS6261499-01 0.1 mL

HBcAg (Hepatitis B Core) (Biotin)

Sign In for Pricing
View Details
HBcAg (Hepatitis B Core) (Biotin)
MBS6261499-02 5x 0.1 mL

HBcAg (Hepatitis B Core) (Biotin)

Sign In for Pricing
View Details
Hsa-miR-6809-3p miRNA Inhibitor
orb1871225-01 10 nmol

Hsa-miR-6809-3p miRNA Inhibitor

Sign In for Pricing
View Details