Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RecombinantGRO-γ/CXCL3, Human (CHO-expressed)

Chemokine (C-X-C motif) ligand 3 (CXCL3) is a small cytokine belonging to the CXC chemokine family that is also known as GRO3 oncogene (GRO3), GRO protein gamma (GROg) and macrophage inflammatory protein-2-beta (MIP2b) . CXCL3 controls migration and adhesion of monocytes and mediates its effect on its target cell by interacting with cell surface chemokine receptor CXCR2. It has been shown that CXCL3 regulates the migration of precursors of cerebellar granule neurons toward the internal layers of the cerebellum, during morphogenesis.Recombinant humanGRO-gamma/CXCL3 produced in CHO cells is a polypeptide chain containing 73 amino acids. A fully biologically active molecule, rhGRO-gamma/CXCL3 has a molecular mass of 9kDa analyzed by reducing SDS-PAGE and is obtained by chromatographic techniques at GenScript.

Product Specifications

CAS Number

9000-83-3

Endotoxin

< 0.2 EU/μg, determined by LAL method.

Purity

> 98% as analyzed by SDS-PAGE.

Bioactivity

The EC50 value of human GRO-gamma/CXCL3 on Caˆ2+ mobilization assay in CHO-K1/Ga15/hCXCR2 cells (human Ga15 and human CXCR2 stably expressed in CHO-K1 cells) is less than 200 ng/ml.

Reconstitution

Reconstituted in ddH2O or PBS at 100 μg/ml.

Molecular Weight

9 kDa, observed by reducing SDS-PAGE.

Storage Conditions

Lyophilized recombinant Human GRO-gamma/CXCL3 remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, Human GRO-gamma/CXCL3 should be stable up to 1 week at 4°C or up to 2 months at -20°C.

Appearance

Sterile Filtered White lyophilized (freeze-dried) powder.

Formulation

Lyophilized after extensive dialysis against PBS.

Host or Source

CHO

Recommended Usage

This material is offered by USA Bioworld biotech for research, laboratory or further evaluation purposes. For research use only.

AA Sequence

ASVVTELRCQCLQTLQGIHLKNIQSVNVRSPGPHCAQTEVIATLKNGKKACLNPASPMVQ KIIEKILNKGSTN

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

AGR3, CT (AGR3, BCMP11, Anterior gradient protein 3 homolog, Breast cancer membrane protein 11) (MaxLight 405) discontinued
031706-ML405 100 µL

AGR3, CT (AGR3, BCMP11, Anterior gradient protein 3 homolog, Breast cancer membrane protein 11) (MaxLight 405) discontinued

Sign In for Pricing
View Details
Porcine endoplasmic reticulum protein 44 (ERP44) ELISA Kit
EIA07786p 1 Kit

Porcine endoplasmic reticulum protein 44 (ERP44) ELISA Kit

Sign In for Pricing
View Details
Mouse KCNJ8 shRNA Plasmid
abx971156-01 150 µg

Mouse KCNJ8 shRNA Plasmid

Sign In for Pricing
View Details
Mouse KCNJ8 shRNA Plasmid
abx971156-02 300 µg

Mouse KCNJ8 shRNA Plasmid

Sign In for Pricing
View Details
Rabbit Polyclonal Biliverdin Reductase A/BLVRA Antibody
NBP3-30352 100 µg

Rabbit Polyclonal Biliverdin Reductase A/BLVRA Antibody

Sign In for Pricing
View Details
Rat Ctgf ELISA Kit
orb566773-01 48 Tests

Rat Ctgf ELISA Kit

Sign In for Pricing
View Details