Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RecombinantGRO-γ/CXCL3, Human (CHO-expressed)

Chemokine (C-X-C motif) ligand 3 (CXCL3) is a small cytokine belonging to the CXC chemokine family that is also known as GRO3 oncogene (GRO3), GRO protein gamma (GROg) and macrophage inflammatory protein-2-beta (MIP2b) . CXCL3 controls migration and adhesion of monocytes and mediates its effect on its target cell by interacting with cell surface chemokine receptor CXCR2. It has been shown that CXCL3 regulates the migration of precursors of cerebellar granule neurons toward the internal layers of the cerebellum, during morphogenesis.Recombinant humanGRO-gamma/CXCL3 produced in CHO cells is a polypeptide chain containing 73 amino acids. A fully biologically active molecule, rhGRO-gamma/CXCL3 has a molecular mass of 9kDa analyzed by reducing SDS-PAGE and is obtained by chromatographic techniques at GenScript.

Product Specifications

CAS Number

9000-83-3

Endotoxin

< 0.2 EU/μg, determined by LAL method.

Purity

> 98% as analyzed by SDS-PAGE.

Bioactivity

The EC50 value of human GRO-gamma/CXCL3 on Caˆ2+ mobilization assay in CHO-K1/Ga15/hCXCR2 cells (human Ga15 and human CXCR2 stably expressed in CHO-K1 cells) is less than 200 ng/ml.

Reconstitution

Reconstituted in ddH2O or PBS at 100 μg/ml.

Molecular Weight

9 kDa, observed by reducing SDS-PAGE.

Storage Conditions

Lyophilized recombinant Human GRO-gamma/CXCL3 remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, Human GRO-gamma/CXCL3 should be stable up to 1 week at 4°C or up to 2 months at -20°C.

Appearance

Sterile Filtered White lyophilized (freeze-dried) powder.

Formulation

Lyophilized after extensive dialysis against PBS.

Host or Source

CHO

Recommended Usage

This material is offered by USA Bioworld biotech for research, laboratory or further evaluation purposes. For research use only.

AA Sequence

ASVVTELRCQCLQTLQGIHLKNIQSVNVRSPGPHCAQTEVIATLKNGKKACLNPASPMVQ KIIEKILNKGSTN

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Mycobacterium Avium nrdI Protein(aa 1-150)
VAng-Yyj1350-50gEcoli 50 µg (E. coli)

Recombinant Mycobacterium Avium nrdI Protein(aa 1-150)

Sign In for Pricing
View Details
Pseudomonas Aeruginosa O12
301722 100 µg

Pseudomonas Aeruginosa O12

Sign In for Pricing
View Details
Human ADAM21 knockout cell line
ABC-KH0247 1 Vial

Human ADAM21 knockout cell line

Sign In for Pricing
View Details
Anti-porcine IFN-γ mAb (P2C11), biotin
3130-6-250 250 µg

Anti-porcine IFN-γ mAb (P2C11), biotin

Sign In for Pricing
View Details
Lentiviral mouse Rab11fip5 shRNA (UAS) - Lentiviral mouse Rab11fip5 shRNA (UAS) plasmid
GTR15291139 1 Vial

Lentiviral mouse Rab11fip5 shRNA (UAS) - Lentiviral mouse Rab11fip5 shRNA (UAS) plasmid

Sign In for Pricing
View Details
Agarose Gel Loading Dye 6X with Ficol
10570002-1 25 mL

Agarose Gel Loading Dye 6X with Ficol

Sign In for Pricing
View Details