RecombinantGRO-α/KC/CXCL1, Mouse (CHO-expressed)
Growth-regulated Alpha Protein (GRO), also known as CXCL-1, GRO1, MGSA and SCYB1, is a chemokine belonging to the intercrine alpha (Chemokine CXC) family. It is expressed mainly by macrophages, neutrophils and epithelial cells. GRO signals through chemokine receptor CXCR1 and CXCR2, and functions to chemoattract and activate neutrophils and basophils. It is also a hematoregulatory chemokine, which suppresses hematopoietic progenitor cell proliferation. GRO has also been reported to play a role in spinal cord development, angiogenesis, wound healing and tumorigenesis.
Product Specifications
CAS Number
9000-83-3
Endotoxin
< 0.2 EU/μg, determined by LAL method.
Purity
> 95% as analyzed by SDS-PAGE and HPLC.
Bioactivity
Active at 10 ng/ml, measured in a tube formation assay using HUVEC cells.
Reconstitution
Reconstituted in ddH2O or PBS at 100 μg/ml.
Molecular Weight
5-7 kDa, observed by reducing SDS-PAGE.
Storage Conditions
Appearance
Sterile Filtered White lyophilized (freeze-dried) powder.
Formulation
Lyophilized after extensive dialysis against PBS.
Host or Source
CHO
Recommended Usage
This material is offered by USA Bioworld biotech for research, laboratory or further evaluation purposes. For research use only.
AA Sequence
APIANELRCQCLQTMAGIHLKNIQSLKVLPSGPHCTQTEVIATLKNGREACLDPEAPLVQKIVQKMLKGVPK
Available Sizes
Frequently Asked Questions
Explore Other Products
Browse additional items from our catalog
M1AP Antibody - middle region : Biotin (ARP52650_P050-Biotin)
Cytokeratin 20 (KRT20) Mouse Monoclonal Antibody [Clone ID: UMAB172]