Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RecombinantGRO/MGSA/CXCL1, Human

GRO/MGSA/CXCL1 has chemotactic activity for neutrophils. It may play a role in inflammation and exerts its effects on endothelial cells in an autocrine fashion. All three isoforms of GRO are CXC chemokines that can signal through the CXCR1 or CXCR2 receptors. GRO expression is inducible by serum or PDGF and/or by a variety of inflammatory mediators, such as IL-1 and TNF, in monocytes, fibroblasts, melanocytes and epithelial cells. In certain tumor cell lines, GRO is expressed constitutively.

Product Specifications

CAS Number

9000-83-3

Endotoxin

< 0.2 EU/μg, determined by LAL method.

Purity

> 95% as analyzed by SDS-PAGE.

Bioactivity

Active, measured in a functional assay using HUVEC cells.

Reconstitution

Reconstituted in ddH2O or PBS at 100 μg/ml.

Molecular Weight

~7.8 kDa, observed by reducing SDS-PAGE.

Storage Conditions

Lyophilized recombinant Human GRO/MGSA/CXCL1 remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, Human GRO/MGSA/CXCL1 should be stable up to 1 week at 4 °C or up to 2 months at -20 °C.

Appearance

Sterile Filtered White lyophilized (freeze-dried) powder.

Formulation

Lyophilized after extensive dialysis against PBS.

Host or Source

CHO

Recommended Usage

This material is offered by USA Bioworld biotech for research, laboratory or further evaluation purposes. For research use only.

AA Sequence

ASVATELRCQCLQTLQGIHPKNIQSVNVKSPGPHCAQTEVIATLKNGRKACLNPASPIVKKIIEKMLNSDKSN

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Sqrdl (Sqor) (NM_001047913) Rat Tagged ORF Clone Lentiviral Particle
RR209592L4V 200 µL

Sqrdl (Sqor) (NM_001047913) Rat Tagged ORF Clone Lentiviral Particle

Ask
View Details
Rabbit Polyclonal TRERF1 Antibody [PerCP]
NB100-81654PCP 0.1 mL

Rabbit Polyclonal TRERF1 Antibody [PerCP]

Ask
View Details
Human PLIN4 Pre-designed siRNA Set B
SI012370B 1 Each

Human PLIN4 Pre-designed siRNA Set B

Ask
View Details
Human MMS2 Antibody
32970-05111 150 µg

Human MMS2 Antibody

Ask
View Details