RecombinantGM-CSF, Mouse
Granulocyte Macrophage Colony Stimulating Factor (GM-CSF) was initially characterized as a growth factor that can support the in vitro colony formation of granulocyte-macrophage progenitors. It is produced by a number of different cell types (including activated T cells, B cells, macrophages, mast cells, endothelial cells and fibroblasts) in response to cytokine or immune and inflammatory stimuli. Besides granulocyte-macrophage progenitors, GM-CSF is also a growth factor for erythroid, megakaryocyte and eosinophil progenitors. On mature hematopoietic cells, GM-CSF is a survival factor for and activates the effectors functions of granulocytes, monocytes/macrophages and eosinophils.
Product Specifications
CAS Number
9000-83-3
Endotoxin
<0.2 EU/μg, determined by LAL method.
Purity
> 95% as analyzed by SDS-PAGE and HPLC.
Bioactivity
ED50 < 0.05 ng/ml, measured in a cell proliferation assay using mouse FDC-P1 cells, corresponding to a specific activity of >2 x 10ˆ7 units/mg.
Reconstitution
Reconstituted in ddH2O or PBS at 100 μg/ml.
Molecular Weight
15~19 kDa, observed by non-reducing SDS-PAGE.
Storage Conditions
Appearance
Sterile Filtered White lyophilized (freeze-dried) powder.
Formulation
Lyophilized after extensive dialysis against PBS.
Host or Source
CHO
Recommended Usage
This material is offered by USA Bioworld biotech for research, laboratory or further evaluation purposes. For research use only.
AA Sequence
APTRSPITVTRPWKHVEAIKEALNLLDDMPVTLNEEVEVVSNEFSFKKLTCVQTRLKIFEQGLRGNFTKLKGALNMTASY YQTYCPPTPETDCETQVTTYADFIDSLKTFLTDIPFECKKPVQK
Available Sizes
Explore Other Products
Browse additional items from our catalog