Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RecombinantGM-CSF, Mouse

Granulocyte Macrophage Colony Stimulating Factor (GM-CSF) was initially characterized as a growth factor that can support the in vitro colony formation of granulocyte-macrophage progenitors. It is produced by a number of different cell types (including activated T cells, B cells, macrophages, mast cells, endothelial cells and fibroblasts) in response to cytokine or immune and inflammatory stimuli. Besides granulocyte-macrophage progenitors, GM-CSF is also a growth factor for erythroid, megakaryocyte and eosinophil progenitors. On mature hematopoietic cells, GM-CSF is a survival factor for and activates the effectors functions of granulocytes, monocytes/macrophages and eosinophils.

Product Specifications

CAS Number

9000-83-3

Endotoxin

<0.2 EU/μg, determined by LAL method.

Purity

> 95% as analyzed by SDS-PAGE and HPLC.

Bioactivity

ED50 < 0.05 ng/ml, measured in a cell proliferation assay using mouse FDC-P1 cells, corresponding to a specific activity of >2 x 10ˆ7 units/mg.

Reconstitution

Reconstituted in ddH2O or PBS at 100 μg/ml.

Molecular Weight

15~19 kDa, observed by non-reducing SDS-PAGE.

Storage Conditions

Lyophilized recombinant murine Granulocyte Macrophage Colony Stimulating Factor (GM-CSF) remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, rmGM-CSF should be stable up to 1 week at 4°C or up to 2 months at -20°C.

Appearance

Sterile Filtered White lyophilized (freeze-dried) powder.

Formulation

Lyophilized after extensive dialysis against PBS.

Host or Source

CHO

Recommended Usage

This material is offered by USA Bioworld biotech for research, laboratory or further evaluation purposes. For research use only.

AA Sequence

APTRSPITVTRPWKHVEAIKEALNLLDDMPVTLNEEVEVVSNEFSFKKLTCVQTRLKIFEQGLRGNFTKLKGALNMTASY YQTYCPPTPETDCETQVTTYADFIDSLKTFLTDIPFECKKPVQK

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Uncharacterized protein C16orf92, C16orf92 ELISA KIT
ELI-33883h 96 Tests

Human Uncharacterized protein C16orf92, C16orf92 ELISA KIT

Sign In for Pricing
View Details
Glutamate Receptor Ionotropic, NMDA 1 (GRIN1) Antibody (ATTO390)
abx440170 100 µg

Glutamate Receptor Ionotropic, NMDA 1 (GRIN1) Antibody (ATTO390)

Sign In for Pricing
View Details
Recombinant Shigella sonnei Ribonuclease 3 (rnc)
MBS1382329-01 0.02 mg (E-Coli)

Recombinant Shigella sonnei Ribonuclease 3 (rnc)

Sign In for Pricing
View Details
Recombinant Shigella sonnei Ribonuclease 3 (rnc)
MBS1382329-02 0.1 mg (E-Coli)

Recombinant Shigella sonnei Ribonuclease 3 (rnc)

Sign In for Pricing
View Details
Recombinant Shigella sonnei Ribonuclease 3 (rnc)
MBS1382329-03 0.02 mg (Yeast)

Recombinant Shigella sonnei Ribonuclease 3 (rnc)

Sign In for Pricing
View Details
Recombinant Shigella sonnei Ribonuclease 3 (rnc)
MBS1382329-04 0.1 mg (Yeast)

Recombinant Shigella sonnei Ribonuclease 3 (rnc)

Sign In for Pricing
View Details