Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RecombinantGM-CSF, Mouse

Granulocyte Macrophage Colony Stimulating Factor (GM-CSF) was initially characterized as a growth factor that can support the in vitro colony formation of granulocyte-macrophage progenitors. It is produced by a number of different cell types (including activated T cells, B cells, macrophages, mast cells, endothelial cells and fibroblasts) in response to cytokine or immune and inflammatory stimuli. Besides granulocyte-macrophage progenitors, GM-CSF is also a growth factor for erythroid, megakaryocyte and eosinophil progenitors. On mature hematopoietic cells, GM-CSF is a survival factor for and activates the effectors functions of granulocytes, monocytes/macrophages and eosinophils.

Product Specifications

CAS Number

9000-83-3

Endotoxin

<0.2 EU/μg, determined by LAL method.

Purity

> 95% as analyzed by SDS-PAGE and HPLC.

Bioactivity

ED50 < 0.05 ng/ml, measured in a cell proliferation assay using mouse FDC-P1 cells, corresponding to a specific activity of >2 x 10ˆ7 units/mg.

Reconstitution

Reconstituted in ddH2O or PBS at 100 μg/ml.

Molecular Weight

15~19 kDa, observed by non-reducing SDS-PAGE.

Storage Conditions

Lyophilized recombinant murine Granulocyte Macrophage Colony Stimulating Factor (GM-CSF) remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, rmGM-CSF should be stable up to 1 week at 4°C or up to 2 months at -20°C.

Appearance

Sterile Filtered White lyophilized (freeze-dried) powder.

Formulation

Lyophilized after extensive dialysis against PBS.

Host or Source

CHO

Recommended Usage

This material is offered by USA Bioworld biotech for research, laboratory or further evaluation purposes. For research use only.

AA Sequence

APTRSPITVTRPWKHVEAIKEALNLLDDMPVTLNEEVEVVSNEFSFKKLTCVQTRLKIFEQGLRGNFTKLKGALNMTASY YQTYCPPTPETDCETQVTTYADFIDSLKTFLTDIPFECKKPVQK

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

ARL6IP4 (ADP-ribosylation Factor-like Protein 6-interacting Protein 4, ARL-6-interacting Protein 4, Aip-4, HSP-975, HSVI-binding Protein, SR-15, SRp25, SR-25, MGC814) (MaxLight 405) discontinued
123536-ML405 100 µL

ARL6IP4 (ADP-ribosylation Factor-like Protein 6-interacting Protein 4, ARL-6-interacting Protein 4, Aip-4, HSP-975, HSVI-binding Protein, SR-15, SRp25, SR-25, MGC814) (MaxLight 405) discontinued

Ask
View Details
Human BCL2 knockout cell line
ABC-KH1385 1 Vial

Human BCL2 knockout cell line

Ask
View Details
BROX Human shRNA Plasmid Kit (Locus ID 148362)
TL306001 1 Kit

BROX Human shRNA Plasmid Kit (Locus ID 148362)

Ask
View Details
Prosc sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)
37744116 3x 1.0 µg

Prosc sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)

Ask
View Details
Anti-METTL1 Antibody
CQA5047-01 30 µL

Anti-METTL1 Antibody

Ask
View Details
Anti-METTL1 Antibody
CQA5047-02 50 μL

Anti-METTL1 Antibody

Ask
View Details