Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RecombinantGH, Human (CHO-expressed)

Growth hormone (GH), also known as somatotropin, is a member of a family of growth factors that includes prolactin, placental lactogens, proliferins, and somatolactin. It is synthesized primarily by somatotropes in the anterior pituitary and is stored in secretary granules. The pulsatile release of GH into circulation is regulated by the concerted actions of the hypothalamic hormones-GH-releasing hormone (GHRH) and somatostatin (SST) - as well as by signals from the periphery - ghrelin and leptin. The human GH cDNA encodes a 217 amino acid (aa) residue precursor protein with a 26 aa putative signal peptide. By alternative splicing, at least four isoforms of GH have been identified.

Product Specifications

CAS Number

9000-83-3

Endotoxin

< 0.2 EU/μg, determined by LAL method.

Purity

> 95% as analyzed by SDS-PAGE and HPLC.

Bioactivity

ED50 < 0.5 ng/ml, measured in a cell proliferation assay using Nb2-11 cells, corresponding to a specific activity of >2 x 10ˆ6 units/mg

Reconstitution

Reconstituted in ddH2O or PBS at 100 μg/ml.

Molecular Weight

20-24 kDa, observed by non-reducing SDS-PAGE.

Storage Conditions

Lyophilized recombinant Human Growth Hormone (GH) remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, rhGH should be stable up to 1 week at 4°C or up to 2 months at -20°C.

Appearance

Sterile Filtered White lyophilized (freeze-dried) powder.

Formulation

Lyophilized after extensive dialysis against PBS.

Host or Source

CHO

Recommended Usage

This material is offered by USA Bioworld biotech for research, laboratory or further evaluation purposes. For research use only.

AA Sequence

FPTIPLSRLFDNASLRAHRLHQLAFDTYQEFEEAYIPKEQKYSFLQNPQTSLCFSESIPTPSNREETQQKSNLELLRISL LLIQSWLEPVQFLRSVFANSLVYGASDSNVYDLLKDLEEGIQTLMGRLEDGSPRTGQIFKQTYSKFDTNSHNDDALLKNY GLLYCFRKDMDKVETFLRIVQCRSVEGSCGF

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

G Protein Coupled Receptor Kinase 4 (GRK4) Antibody
abx125908-01 60 µL

G Protein Coupled Receptor Kinase 4 (GRK4) Antibody

Sign In for Pricing
View Details
G Protein Coupled Receptor Kinase 4 (GRK4) Antibody
abx125908-02 120 µL

G Protein Coupled Receptor Kinase 4 (GRK4) Antibody

Sign In for Pricing
View Details
G Protein Coupled Receptor Kinase 4 (GRK4) Antibody
abx125908-03 200 µL

G Protein Coupled Receptor Kinase 4 (GRK4) Antibody

Sign In for Pricing
View Details
Human IL5 ELISA Kit
ELA-E0078h 96 Tests

Human IL5 ELISA Kit

Sign In for Pricing
View Details
Mouse IL-22 ELISA Kit
EMI0210 96 Tests

Mouse IL-22 ELISA Kit

Sign In for Pricing
View Details
Sheep Tropomyosin 2 Beta ELISA Kit
MBS076066-01 48 Well

Sheep Tropomyosin 2 Beta ELISA Kit

Sign In for Pricing
View Details