Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RecombinantGDNF, Human

Glial cell line-derived neurotrophic factor (G-DNF) is a neurotrophic factors belong to TGF-beta super family necessary for neuron survival and phenotypic maintenance in central and peripheral nervous systems [1]. G-DNF has the potent to support the differentiation and survival of many neuron subpopulations, prominent for dopaminergic neurons [2] and motor neurons [3], as well as Purkinje cells and sympathetic neurons. Sertoli cells, type 1 astrocytes, Schwann cells, neurons, pinealocytes and skeletal muscle cells are known to express GDNF in human [4]. GDNF has shown to interact with GFRA2 and GDNF family receptor alpha 1 [5,6]. Mutations in this gene may be associated with Hirschsprung's disease, Parkinson's disease and amyotrophic lateral sclerosis (ALS) [7].The recombinant human G-DNF expressed in CHO cells is disulfide-linked homo-dimer, with an apparent molecular weight of ~30.4 kDa.

Product Specifications

CAS Number

9000-83-3

Endotoxin

<0.2 EU/μg, determined by LAL method.

Purity

> 95% as analyzed by SDS-PAGE and HPLC.

Bioactivity

ED50< 1 µg/ml, measured in a cell proliferation assay using rat C6 cells, corresponding to a specific activity of >1 x 10ˆ3 units/mg

Reconstitution

Reconstituted in ddH2O or PBS at 100 μg/ml.

Molecular Weight

30.4 kDa (homo-dimer), observed by non-reducing SDS-PAGE.

Storage Conditions

Lyophilized recombinant human Glial cell line-derived neurotrophic factor (G-DNF) remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, rhG-DNF should be stable up to 1 week at 4°C or up to 2 months at -20°C.

Appearance

Sterile Filtered White lyophilized (freeze-dried) powder.

Formulation

Lyophilized after extensive dialysis against PBS.

Host or Source

CHO

Recommended Usage

This material is offered by USA Bioworld biotech for research, laboratory or further evaluation purposes. For research use only.

AA Sequence

RGQRGKNRGCVLTAIHLNVTDLGLGYETKEELIFRYCSGSCDAAETTYDKILKNLSRNRRLVSDKVGQACCRPIAFDDDL SFLDDNLVYHILRKHSAKRCGCI

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Hoxc13 (NM_010464) Mouse Untagged Clone
MC208690 10 µg

Hoxc13 (NM_010464) Mouse Untagged Clone

Ask
View Details
Myosin heavy chain 2 Recombinant Antibody, APC-Cy5.5 Conjugated
bsm-62856R-APC-Cy5.5 100 µL

Myosin heavy chain 2 Recombinant Antibody, APC-Cy5.5 Conjugated

Ask
View Details
Luc-GFP-HEK293 Cells
LGL01 1 Vial

Luc-GFP-HEK293 Cells

Ask
View Details
Recombinant Escherichia coli O157:H7 S-formylglutathione hydrolase frmB (frmB)
MBS1360130-01 0.02 mg (E-Coli)

Recombinant Escherichia coli O157:H7 S-formylglutathione hydrolase frmB (frmB)

Ask
View Details
Recombinant Escherichia coli O157:H7 S-formylglutathione hydrolase frmB (frmB)
MBS1360130-02 0.02 mg (Yeast)

Recombinant Escherichia coli O157:H7 S-formylglutathione hydrolase frmB (frmB)

Ask
View Details
Recombinant Escherichia coli O157:H7 S-formylglutathione hydrolase frmB (frmB)
MBS1360130-03 0.1 mg (E-Coli)

Recombinant Escherichia coli O157:H7 S-formylglutathione hydrolase frmB (frmB)

Ask
View Details