Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RecombinantFlt-3L, Human

Fms-related tyrosine kinase 3 ligand (Flt3L) is growth fator stimulates the proliferation and differentiation of hematopoietic multipotent progenitors and promotes proliferation of NK cells and dendritic cell subgroups by combination with other growth factors. Flt3L is produced by T cells and stromal fibroblasts, and targeted various cells including hematopoietic stem cells, B cells, T cells, dendritic cells, and NK cells [1][2]. Flt3L binds to it cognate tyrosine kinase receptor Flt3 and activates JAK/STAT signaling pathway[3].Flt3L is a hematopoietic four helical bundle cytokine with structurally homologous to stem cell factor (SCF) and colony stimulating facor 1 (CSF-1) demonstrated four conserved cysteines and two glycosylation sites. Flt3L naturally as a non-disulfide-linked homodimer with multiple isoforms. The extracellular portion is approximately 160 amino acid residues in length and the cytoplasmic segment is approximately 20-30 amino acid residues in length[4].

Product Specifications

CAS Number

9000-83-3

Endotoxin

<0.2 EU/μg, determined by LAL method.

Purity

> 95% as analyzed by SDS-PAGE and HPLC.

Bioactivity

ED50< 1 ng/ml, measured in a cell proliferation assay of human AML5 cells, corresponding to a specific activity of > 1 x 10ˆ6 units/mg

Reconstitution

Reconstituted in ddH2O or PBS at 100 μg/ml.

Molecular Weight

Multiple bands between 18~22 kDa, observed by reducing SDS-PAGE.

Storage Conditions

Lyophilized recombinant human Fms-related tyrosine kinase 3 ligand (Flt-3 Ligand) remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, rhFlt-3L should be stable up to 1 week at 4°C or up to 2 months at -20°C.

Appearance

Sterile Filtered White lyophilized (freeze-dried) powder.

Formulation

Lyophilized after extensive dialysis against PBS.

Host or Source

CHO

Recommended Usage

This material is offered by USA Bioworld biotech for research, laboratory or further evaluation purposes. For research use only.

AA Sequence

TQDCSFQHSPISSDFAVKIRELSDYLLQDYPVTVASNLQDEELCGGLWRLVLAQRWMERLKTVAGSKMQGLLERVNTEIH FVTKCAFQPPPSCLRFVQTNISRLLQETSEQLVALKPWITRQNFSRCLELQCQPDSSTLPPPWSPRPLEATAPTA

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

MAPK1 Antibody
XW-7183 0.05 mg

MAPK1 Antibody

Ask
View Details
PDGF Beta-Receptor (739-746) (Phosphorylated) Peptide
PE-89818-01 1 mg

PDGF Beta-Receptor (739-746) (Phosphorylated) Peptide

Ask
View Details
PDGF Beta-Receptor (739-746) (Phosphorylated) Peptide
PE-89818-02 5 mg

PDGF Beta-Receptor (739-746) (Phosphorylated) Peptide

Ask
View Details
PDGF Beta-Receptor (739-746) (Phosphorylated) Peptide
PE-89818-03 10 mg

PDGF Beta-Receptor (739-746) (Phosphorylated) Peptide

Ask
View Details
Tau (S305) Antibody
KC-42882-01 50 μL

Tau (S305) Antibody

Ask
View Details
Tau (S305) Antibody
KC-42882-02 100 µL

Tau (S305) Antibody

Ask
View Details