Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RecombinantFlt-3L, His, Mouse

Flt3L, also known as Fms-related tyrosine kinase 3 ligand and SL cytokine, is a single-pass type I membrane protein. It is expressed by stromal cells and T cells. Flt3L signals through tyrosine kinase receptor Flt3/Flk2 to stimulate the proliferation of early hematopoietic progenitor cells. It synergizes with other growth factors, such as GM-CSF, IL-3 and CSF, to promote the differentiation of both myeloid and lymphoid cells. Alternative splicing and proteolytic cleavage of membrane-bound Flt3L generates a soluble extracellular domain (ECD) isoform with full biological activity.

Product Specifications

CAS Number

9000-83-3

Endotoxin

< 0.2 EU/μg, determined by LAL method.

Purity

> 95% as analyzed by SDS-PAGE.

Bioactivity

ED50 < 10 ng /ml, measured in a cell proliferation assay using AML5 cells.

Reconstitution

Reconstituted in ddH2O or PBS at 100 μg/ml.

Molecular Weight

24-30 kDa, observed by reducing SDS-PAGE.

Storage Conditions

Lyophilized recombinant murine Flt3L, His remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, murine Flt3L, His should be stable up to 1 week at 4°C or up to 2 months at -20°C.

Appearance

Sterile Filtered White lyophilized (freeze-dried) powder.

Formulation

Lyophilized after extensive dialysis against PBS.

Host or Source

CHO

Recommended Usage

This material is offered by USA Bioworld biotech for research, laboratory or further evaluation purposes. For research use only.

AA Sequence

GTPDCYFSHSPISSNFKVKFRELTDHLLKDYPVTVAVNLQDEKHCKALWSLFLAQRWIEQLKTVAGSKMQTLLEDVNTEI HFVTSCTFQPLPECLRFVQTNISHLLKDTCTQLLALKPCIGKACQNFSRCLEVQCQPDSSTLLPPRSPIALEATELPEPR PRHHHHHH

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Bovine alpha-L-iduronidase(IDUA) ELISA Kit
MBS2608659-01 48 Well

Bovine alpha-L-iduronidase(IDUA) ELISA Kit

Ask
View Details
Bovine alpha-L-iduronidase(IDUA) ELISA Kit
MBS2608659-02 96 Well

Bovine alpha-L-iduronidase(IDUA) ELISA Kit

Ask
View Details
Bovine alpha-L-iduronidase(IDUA) ELISA Kit
MBS2608659-03 5x 96 Well

Bovine alpha-L-iduronidase(IDUA) ELISA Kit

Ask
View Details
Bovine alpha-L-iduronidase(IDUA) ELISA Kit
MBS2608659-04 10x 96 Well

Bovine alpha-L-iduronidase(IDUA) ELISA Kit

Ask
View Details
CD79A, CT (CD79A, IGA, MB1, B Cell antigen receptor complex-associated protein alpha chain, Ig-alpha, MB-1 membrane glycoprotein, Membrane-bound immunoglobulin-associated protein, Surface IgM-associated protein, CD_antigen=CD79a) (PE) discontinued
030862-PE 200 µL

CD79A, CT (CD79A, IGA, MB1, B Cell antigen receptor complex-associated protein alpha chain, Ig-alpha, MB-1 membrane glycoprotein, Membrane-bound immunoglobulin-associated protein, Surface IgM-associated protein, CD_antigen=CD79a) (PE) discontinued

Ask
View Details
Anti-Human MRPL12 Polyclonal Antibody
HC170014-01 50 µg

Anti-Human MRPL12 Polyclonal Antibody

Ask
View Details