Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RecombinantFGF-21, His, Human

FGF-21, also known as fibroblast growth factor-21 and FGFL, is a secreted growth factor belonging to theheparin-binding growth factor family. It is produced by hepatocytes in response to fatty acid stimulation. FGF-21 couples with its co-factor beta-Klotho to signal through FGFR1c and FGFR4. Signal transduction results in insulin-independent uptake of glucose by adipocytes. Clinical administration of FGF-21 induces energy expenditure, fat utilization and lipid excretion.

Product Specifications

CAS Number

9000-83-3

Endotoxin

<0.2 EU/μg, determined by LAL method.

Purity

> 95% as analyzed by SDS-PAGE.

Bioactivity

ED50<0.3μg/ml, measured in a bioassay using NIH-3T3 cells.

Reconstitution

Reconstituted in ddH2O or PBS at 100 μg/ml.

Molecular Weight

23-25kDa, observed by reducing SDS-PAGE.

Storage Conditions

Lyophilized recombinant human FGF-21 remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, human FGF-21, His should be stable up to 1 week at 4°C or up to 2 months at -20°C.

Appearance

Sterile Filtered White lyophilized (freeze-dried) powder.

Formulation

Lyophilized after extensive dialysis against PBS.

Host or Source

CHO

Recommended Usage

This material is offered by USA Bioworld biotech for research, laboratory or further evaluation purposes. For research use only.

AA Sequence

HPIPDSSPLLQFGGQVRQRYLYTDDAQQTEAHLEIREDGTVGGAADQSPESLLQLKALKPGVIQILGVKTSRFLCQRPDG ALYGSLHFDPEACSFRELLLEDGYNVYQSEAHGLPLHLPGNKSPHRDPAPRGPARFLPLPGLPPALPEPPGILAPQPPDV GSSDPLSMVGPSQGRSPSYASHHHHHH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-HLA DMB/HLA-DMB Antibody Picoband®, FITC Conjugate
PA1788-FITC 100 µg/Vial

Anti-HLA DMB/HLA-DMB Antibody Picoband®, FITC Conjugate

Sign In for Pricing
View Details
Wdr4 Mouse shRNA Lentiviral Particle (Locus ID 57773)
TL512429V 500 µL Each

Wdr4 Mouse shRNA Lentiviral Particle (Locus ID 57773)

Sign In for Pricing
View Details
NFKappaB-p105 Polyclonal Antibody
JOT-AP05977-01 20 µL

NFKappaB-p105 Polyclonal Antibody

Sign In for Pricing
View Details
NFKappaB-p105 Polyclonal Antibody
JOT-AP05977-02 50 μL

NFKappaB-p105 Polyclonal Antibody

Sign In for Pricing
View Details
NFKappaB-p105 Polyclonal Antibody
JOT-AP05977-03 100 µL

NFKappaB-p105 Polyclonal Antibody

Sign In for Pricing
View Details
1- (3-Amino-benzofuran-2-yl) -ethanone
sc-297298 500 mg

1- (3-Amino-benzofuran-2-yl) -ethanone

Sign In for Pricing
View Details