Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RecombinantFGF-16, Human

Fibroblast Growth Factor-16 (FGF-16) is a heparin binding growth factor, a member of the FGF family. All FGF family members are heparin­binding growth factors with a core 120 amino acid (aa) FGF domain that allows for a common tertiary structure. FGF family members possess broad mitogenic and cell survival activities, and are involved in a variety of biological processes, including embryonic development, cell growth, morphogenesis, tissue repair, tumor growth and invasion. The rat homolog is predominantly expressed in embryonic brown adipose tissue and has significant mitogenic activity, which suggests a role in proliferation of embryonic brown adipose tissue. FGF-16 is most similar to FGF-9 (73 % amino acid identity) . The protein sequence of human FGF-16 displays 98.6% identity with rat FGF-16. Chimpanzee FGF-16 (207 amino acids), chicken FGF-16 (207 amino acids), and zebrafish FGF-16 (203 amino acids) show 100 %, 89.9 %, and 79.2 % total amino acid identity with human FGF-16.Recombinant human FGF-16 produced in CHO cells is a polypeptide chain containing 206 amino acids. A fully biologically active molecule, rhFGF-16 has a molecular mass of 23 kDa analyzed by reducing SDS-PAGE and is obtained by chromatographic techniques at GenScript.

Product Specifications

Endotoxin

< 0.2 EU/μg, determined by LAL method.

Purity

> 95% as analyzed by SDS-PAGE and HPLC.

Bioactivity

Measured in a cell proliferation assay using 3T3 mouse fibroblast cell, The ED50 for this effect is < 20 ng/mL.

Reconstitution

Reconstituted in ddH2O or PBS at 100 μg/ml.

Molecular Weight

23 kDa, observed by reducing SDS-PAGE.

Storage Conditions

Lyophilized recombinant Human Fibroblast Growth Factor-16 remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, Human Fibroblast Growth Factor-16 should be stable up to 1 week at 4°C or up to 3 months at -20°C.

Appearance

Sterile Filtered White lyophilized (freeze-dried) powder.

Formulation

Lyophilized after extensive dialysis against PBS.

Host or Source

CHO

Recommended Usage

This material is offered by USA Bioworld biotech for research, laboratory or further evaluation purposes. For research use only.

CAS Number

9000-83-3

AA Sequence

AEVGGVFASLDWDLHGFSSSLGNVPLADSPGFLNERLGQIEGKLQRGSPTDFAHLKGILRRRQLYCRTGFHLEIFPNGTV HGTRHDHSRFGILEFISLAVGLISIRGVDSGLYLGMNERGELYGSKKLTRECVFREQFEENWYNTYASTLYKHSDSERQY YVALNKDGSPREGYRTKRHQKFTHFLPRPVDPSKLPSMSRDLFHYR

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

IL-11 Polyclonal Antibody, AbBy Fluor™ 594 Conjugated
bs-1827R-BF594-TR 20 µL

IL-11 Polyclonal Antibody, AbBy Fluor™ 594 Conjugated

Ask
View Details
Bone Sialoprotein (BSP) Magnetic Fluorescence Assay Kit
MBS2156924-01 96 Tests

Bone Sialoprotein (BSP) Magnetic Fluorescence Assay Kit

Ask
View Details
Bone Sialoprotein (BSP) Magnetic Fluorescence Assay Kit
MBS2156924-02 5x 96 Tests

Bone Sialoprotein (BSP) Magnetic Fluorescence Assay Kit

Ask
View Details
Bone Sialoprotein (BSP) Magnetic Fluorescence Assay Kit
MBS2156924-03 10x 96 Tests

Bone Sialoprotein (BSP) Magnetic Fluorescence Assay Kit

Ask
View Details
Grwd1 Mouse qPCR Template Standard (NM_153419)
MK204593 1 Kit

Grwd1 Mouse qPCR Template Standard (NM_153419)

Ask
View Details
Human CAMK1D Protein, GST Tag
E40KMPH2304 20 µg

Human CAMK1D Protein, GST Tag

Ask
View Details