Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RecombinantEGFR, His, Human

EGF Receptor, also known as ERBB, ERBB1 and HER1, is a type I transmembrane protein belonging to the tyrosine protein kinase family. It binds to a subset of EGF family ligands, including EGF, TGF-alpha, amphiregulin, EPGN, BTC, EREG and HBEGF. Ligand binding triggers receptor homo- or hetero-dimerization, which induces downstream kinase activation, tyrosine phosphorylation and cell signaling. EGF receptor signaling has been shown to regulate cell proliferation, differentiation, motility and apoptosis.

Product Specifications

CAS Number

9000-83-3

Endotoxin

< 0.2 EU/μg, determined by LAL method.

Purity

> 95% as analyzed by SDS-PAGE.

Bioactivity

ED50< 1 μg/ml, measured in a bioassay using 3T3 cells in the presence of 25 pg/ml human EGF.

Reconstitution

Reconstituted in ddH2O or PBS at 100 μg/ml.

Molecular Weight

95-115 kDa, observed by reducing SDS-PAGE.

Storage Conditions

Lyophilized recombinant human EGF Receptor, Hisremains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, human EGF Receptor, His should be stable up to 1 week at 4°C or up to 2 months at -20°C.

Appearance

Sterile Filtered White lyophilized (freeze-dried) powder.

Formulation

Lyophilized after extensive dialysis against PBS.

Host or Source

CHO

Recommended Usage

This material is offered by USA Bioworld biotech for research, laboratory or further evaluation purposes. For research use only.

AA Sequence

LEEKKVCQGTSNKLTQLGTFEDHFLSLQRMFNNCEVVLGNLEITYVQRNYDLSFLKTIQEVAGYVLIALNTVERIPLENL QIIRGNMYYENSYALAVLSNYDANKTGLKELPMRNLQEILHGAVRFSNNPALCNVESIQWRDIVSSDFLSNMSMDFQNHL GSCQKCDPSCPNGSCWGAGEENCQKLTKIICAQQCSGRCRGKSPSDCCHNQCAAGCTGPRESDCLVCRKFRDEATCKDTC PPLMLYNPTTYQMDVNPEGKYSFGATCVKKCPRNYVVTDHGSCVRACGADSYEMEEDGVRKCKKCEGPCRKVCNGIGIGE FKDSLSINATNIKHFKNCTSISGDLHILPVAFRGDSFTHTPPLDPQELDILKTVKEITGFLLIQAWPENRTDLHAFENLE IIRGRTKQHGQFSLAVVSLNITSLGLRSLKEISDGDVIISGNKNLCYANTINWKKLFGTSGQKTKIISNRGENSCKATGQ VCHALCSPEGCWGPEPRDCVSCRNVSRGRECVDKCNLLEGEPREFVENSECIQCHPECLPQAMNITCTGRGPDNCIQCAH YIDGPHCVKTCPAGVMGENNTLVWKYADAGHVCHLCHPNCTYGCTGPGLEGCPTNGPKIPSHHHHHH

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD363 (Phospho-T236) Antibody
E38PA4516 100 µL

CD363 (Phospho-T236) Antibody

Sign In for Pricing
View Details
Goose Solute Carrier Family 22 Member 1 (SLC22A1) ELISA Kit
MBS9352430 Inquire

Goose Solute Carrier Family 22 Member 1 (SLC22A1) ELISA Kit

Sign In for Pricing
View Details
C5AR1, ID (C5AR1, C5AR, C5R1, C5a anaphylatoxin chemotactic receptor, CD88) (MaxLight 650) discontinued
032998-ML650 100 µL

C5AR1, ID (C5AR1, C5AR, C5R1, C5a anaphylatoxin chemotactic receptor, CD88) (MaxLight 650) discontinued

Sign In for Pricing
View Details
Beta Cyclocitral-BSA
900109BA 2 mg

Beta Cyclocitral-BSA

Sign In for Pricing
View Details
Rat Fibulin 7 (FBLN7) Protein
abx650666-01 10 µg

Rat Fibulin 7 (FBLN7) Protein

Sign In for Pricing
View Details
Rat Fibulin 7 (FBLN7) Protein
abx650666-02 50 µg

Rat Fibulin 7 (FBLN7) Protein

Sign In for Pricing
View Details