Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RecombinantDKK-1, Mouse

Dickkopf related protein 1 (DKK1) is a chemokine that belongs to the DKK protein family, which also includes DKK-2, DKK-3 and DKK-4. DKK-1 was originally identified as a Xenopus head forming molecule that behaves as an antagonist for Wnt signaling. It is one of the most up-regulated genes during androgen-potentiated balding, with DKK-1 messenger RNA up-regulated a few hours after DHT treatment of hair follicles at the dermal papilla in vitro. Neutralizing bodies against DKK-1 reverses DHT effects on outer root sheath keratinocytes. DKK-1 expression is attenuated by L-threonate, a metabolite of ascorbate in vitro. DKK-1 promotes LRP6 internalization and degradation as it forms a ternary complex with the cell surface receptor Kremen. DKK-1 not only functions in head formation during development, but also regulates joint remodeling and bone formation indicating its potential role in the pathogenesis of rheumatoid arthritis and multiple myeloma.Recombinant Mouse Dickkopf-related protein 1 produced in CHO cells is a polypeptide chain containing 243 amino acids. A fully biologically active molecule, rmDKK-1 has a molecular mass of 19~20 kDa analyzed by reducing SDS-PAGE and is obtained by chromatographic techniques at GenScript.

Product Specifications

CAS Number

9000-83-3

Endotoxin

< 0.2 EU/μg, determined by LAL method.

Purity

> 95% as analyzed by SDS-PAGE.

Bioactivity

ED50 < 6 µg/ml, measured in stimulation of alkaline phosphatase activity using CCl-226 cells.

Reconstitution

Reconstituted in ddH2O or PBS at 100 μg/ml.

Molecular Weight

19-20 kDa, observed by reducing SDS-PAGE.

Storage Conditions

Lyophilized recombinant Mouse Dickkopf-related protein 1 remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, Mouse Dickkopf-related protein 1 should be stable up to 1 week at 4°C or up to 3 months at -20°C.

Appearance

Sterile Filtered White lyophilized (freeze-dried) powder.

Formulation

Lyophilized after extensive dialysis against PBS.

Host or Source

CHO

Recommended Usage

This material is offered by USA Bioworld biotech for research, laboratory or further evaluation purposes. For research use only.

AA Sequence

SATLNSVLINSNAIKNLPPPLGGAGGQPGSAVSVAPGVLYEGGNKYQTLDNYQPYPCAEDEE CGSDEYCSSPSRGAAGVGGVQICLACRKRRKRCMRHAMCCPGNYCKNGICMPSDHSHFPR GEIEESIIENLGNDHNAAAGDGYPRRTTLTSKIYHTKGQEGSVCLRSSDCAAGLCCARHF WSKICKPVLKEGQVCTKHKRKGSHGLEIFQRCYCGEGLACRIQKDHHQASNSSRLHTCQR H

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

AllA Antibody
orb809293 2 mg

AllA Antibody

Sign In for Pricing
View Details
Lentiviral human FZD3 shRNA (UAS) - Lentiviral human FZD3 shRNA (UAS, RFP) (100)
GTR15332907 1 Vial

Lentiviral human FZD3 shRNA (UAS) - Lentiviral human FZD3 shRNA (UAS, RFP) (100)

Sign In for Pricing
View Details
ATG12 Antibody, mAb, Rabbit
A03957-100 100 µL

ATG12 Antibody, mAb, Rabbit

Sign In for Pricing
View Details
Human IgG3 Recombinant Antibody, Biotin Conjugated
bsm-61621R-Biotin-TR 20 µL

Human IgG3 Recombinant Antibody, Biotin Conjugated

Sign In for Pricing
View Details
Lentiviral mouse Adm2 shRNA (UAS) - Lentiviral mouse Adm2 shRNA (UAS, RFP) (100)
GTR15241872 1 Vial

Lentiviral mouse Adm2 shRNA (UAS) - Lentiviral mouse Adm2 shRNA (UAS, RFP) (100)

Sign In for Pricing
View Details
UBE3A (D10D3) Rabbit Monoclonal Antibody
CST 7526T 20 µL

UBE3A (D10D3) Rabbit Monoclonal Antibody

Sign In for Pricing
View Details